Recombinant Full Length Human FBP2 Protein, GST-tagged
| Cat.No. : | FBP2-4897HF |
| Product Overview : | Human FBP2 full-length ORF ( NP_003828.2, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 339 amino acids |
| Description : | This gene encodes a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 63.1 kDa |
| AA Sequence : | MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FBP2 fructose-1,6-bisphosphatase 2 [ Homo sapiens ] |
| Official Symbol | FBP2 |
| Synonyms | FBP2; fructose-1,6-bisphosphatase 2; fructose-1,6-bisphosphatase isozyme 2; FBPase 2; hexosediphosphatase; muscle fructose-bisphosphatase; D-fructose-1,6-bisphosphate 1-phosphohydrolase 2; MGC142192; |
| Gene ID | 8789 |
| mRNA Refseq | NM_003837 |
| Protein Refseq | NP_003828 |
| MIM | 603027 |
| UniProt ID | O00757 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBP2 Products
Required fields are marked with *
My Review for All FBP2 Products
Required fields are marked with *



