Recombinant Full Length Human FBXL15 Protein, GST-tagged
Cat.No. : | FBXL15-4946HF |
Product Overview : | Human FBXL15 full-length ORF (1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 296 amino acids |
Description : | FBXL15 (F-Box And Leucine Rich Repeat Protein 15) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include ubiquitin-protein transferase activity. An important paralog of this gene is FBXL20. |
Molecular Mass : | 58.96 kDa |
AA Sequence : | MEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFRSLVQLHLAGLRRFDAAQVGPQIPRAALARLLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVALGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRGAGLRSLSLAVNANVGDAAVQELARNCPELHHLDLTGCLRVGSDGVRTLAEYCPVLRSLRVRHCHHVAESSLSRLRKRGVDIDVEPPLHQALVLLQDMAGFAPFVNLQV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBXL15 F-box and leucine-rich repeat protein 15 [ Homo sapiens ] |
Official Symbol | FBXL15 |
Synonyms | FBXL15; F-box and leucine-rich repeat protein 15; F box only protein 37 , FBXO37; F-box/LRR-repeat protein 15; Fbl15; MGC11279; F-box only protein 37; pleckstrin and Sec7 domain protein; JET; PSD; FBXO37; FLJ16137; |
Gene ID | 79176 |
mRNA Refseq | NM_024326 |
Protein Refseq | NP_077302 |
MIM | 610287 |
UniProt ID | Q9H469 |
◆ Recombinant Proteins | ||
FBXL15-4946HF | Recombinant Full Length Human FBXL15 Protein, GST-tagged | +Inquiry |
FBXL15-12193Z | Recombinant Zebrafish FBXL15 | +Inquiry |
FBXL15-1942R | Recombinant Rat FBXL15 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXL15-3891H | Recombinant Human FBXL15 Protein, GST-tagged | +Inquiry |
FBXL15-12773H | Recombinant Human FBXL15, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXL15-272HCL | Recombinant Human FBXL15 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXL15 Products
Required fields are marked with *
My Review for All FBXL15 Products
Required fields are marked with *
0
Inquiry Basket