Recombinant Full Length Human FBXL15 Protein, GST-tagged

Cat.No. : FBXL15-4946HF
Product Overview : Human FBXL15 full-length ORF (1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 296 amino acids
Description : FBXL15 (F-Box And Leucine Rich Repeat Protein 15) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include ubiquitin-protein transferase activity. An important paralog of this gene is FBXL20.
Molecular Mass : 58.96 kDa
AA Sequence : MEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFRSLVQLHLAGLRRFDAAQVGPQIPRAALARLLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVALGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRGAGLRSLSLAVNANVGDAAVQELARNCPELHHLDLTGCLRVGSDGVRTLAEYCPVLRSLRVRHCHHVAESSLSRLRKRGVDIDVEPPLHQALVLLQDMAGFAPFVNLQV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FBXL15 F-box and leucine-rich repeat protein 15 [ Homo sapiens ]
Official Symbol FBXL15
Synonyms FBXL15; F-box and leucine-rich repeat protein 15; F box only protein 37 , FBXO37; F-box/LRR-repeat protein 15; Fbl15; MGC11279; F-box only protein 37; pleckstrin and Sec7 domain protein; JET; PSD; FBXO37; FLJ16137;
Gene ID 79176
mRNA Refseq NM_024326
Protein Refseq NP_077302
MIM 610287
UniProt ID Q9H469

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBXL15 Products

Required fields are marked with *

My Review for All FBXL15 Products

Required fields are marked with *

0
cart-icon