Recombinant Full Length Human FBXL8 Protein, GST-tagged
Cat.No. : | FBXL8-5006HF |
Product Overview : | Human FBXL8 full-length ORF ( AAH14414, 1 a.a. - 374 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 374 amino acids |
Description : | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class. It shares 78% sequence identity with the mouse protein. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 66.88 kDa |
AA Sequence : | MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAHCPRLRTYTLKLTREPHPWRPTLVA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBXL8 F-box and leucine-rich repeat protein 8 [ Homo sapiens ] |
Official Symbol | FBXL8 |
Synonyms | FBXL8; F-box and leucine-rich repeat protein 8; F-box/LRR-repeat protein 8; Fbl8; F-box protein FBL8; FBL8; FLJ11278; MGC19959; |
Gene ID | 55336 |
mRNA Refseq | NM_018378 |
Protein Refseq | NP_060848 |
MIM | 609077 |
UniProt ID | Q96CD0 |
◆ Recombinant Proteins | ||
FBXL8-5058C | Recombinant Chicken FBXL8 | +Inquiry |
FBXL8-5006HF | Recombinant Full Length Human FBXL8 Protein, GST-tagged | +Inquiry |
FBXL8-5059C | Recombinant Chicken FBXL8 | +Inquiry |
Fbxl8-2963M | Recombinant Mouse Fbxl8 Protein, Myc/DDK-tagged | +Inquiry |
FBXL8-3912H | Recombinant Human FBXL8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXL8-602HCL | Recombinant Human FBXL8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXL8 Products
Required fields are marked with *
My Review for All FBXL8 Products
Required fields are marked with *
0
Inquiry Basket