Recombinant Full Length Human FBXO27 Protein, GST-tagged
| Cat.No. : | FBXO27-5029HF |
| Product Overview : | Human FBXO27 full-length ORF ( NP_849142.1, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 283 amino acids |
| Description : | Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008] |
| Molecular Mass : | 58 kDa |
| AA Sequence : | MGASVSRGRAARVPAPEPEPEEALDLSQLPPELLLVVLSHVPPRTLLGRCRQVCRGWRALVDGQALWLLILARDHGATGRALLHLARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCGQEGLRKWMVQHGGDGWVVEENRTTVPGAPSQTCFVTSFSWCCKKQVLDLEEEGLWPELLDSGRIEICVSDWWGARHDSGCMYRLLVQLLDANQTVLDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAGHYGARVTNSSVIVRVRLS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FBXO27 F-box protein 27 [ Homo sapiens ] |
| Official Symbol | FBXO27 |
| Synonyms | FBXO27; F-box protein 27; F box only protein 27; F-box only protein 27; Fbg5; Fbx27; F-box protein FBG5; F-box/G-domain protein 5; FBG5; |
| Gene ID | 126433 |
| mRNA Refseq | NM_178820 |
| Protein Refseq | NP_849142 |
| MIM | 609099 |
| UniProt ID | Q8NI29 |
| ◆ Recombinant Proteins | ||
| FBXO27-518C | Recombinant Cynomolgus FBXO27 Protein, His-tagged | +Inquiry |
| FBXO27-3098H | Recombinant Human FBXO27 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FBXO27-3925H | Recombinant Human FBXO27 Protein, GST-tagged | +Inquiry |
| FBXO27-263C | Recombinant Cynomolgus Monkey FBXO27 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Fbxo27-2965M | Recombinant Mouse Fbxo27 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FBXO27-6302HCL | Recombinant Human FBXO27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO27 Products
Required fields are marked with *
My Review for All FBXO27 Products
Required fields are marked with *
