Recombinant Full Length Human FBXW7 Protein, GST-tagged
Cat.No. : | FBXW7-4724HF |
Product Overview : | Human FBXW7 full-length ORF (BAA91986.1, 1 a.a. - 553 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 553 amino acids |
Description : | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene was previously referred to as FBX30, and belongs to the Fbws class; in addition to an F-box, this protein contains 7 tandem WD40 repeats. This protein binds directly to cyclin E and probably targets cyclin E for ubiquitin-mediated degradation. Mutations in this gene are detected in ovarian and breast cancer cell lines, implicating the gene's potential role in the pathogenesis of human cancers. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2012] |
Molecular Mass : | 88.7 kDa |
AA Sequence : | MGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBXW7 F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase [ Homo sapiens ] |
Official Symbol | FBXW7 |
Synonyms | FBXW7; F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase; F box and WD repeat domain containing 7 , F box and WD 40 domain protein 7 (archipelago homolog, Drosophila); F-box/WD repeat-containing protein 7; AGO; archipelago homolog (Drosophila); CDC4; FBW7; FBX30; FBXW6; FLJ11071; SEL 10; SEL10; archipelago; F-box protein FBW7; F-box protein FBX30; F-box protein SEL-10; homolog of C elegans sel-10; F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila); FBW6; hAgo; hCdc4; FBXO30; SEL-10; FLJ16457; DKFZp686F23254; |
Gene ID | 55294 |
mRNA Refseq | NM_001013415 |
Protein Refseq | NP_001013433 |
MIM | 606278 |
UniProt ID | Q969H0 |
◆ Recombinant Proteins | ||
FBXW7-1672R | Recombinant Rhesus monkey FBXW7 Protein, His-tagged | +Inquiry |
FBXW7-3173H | Recombinant Human FBXW7 protein, His-tagged | +Inquiry |
Fbxw7-1734M | Recombinant Mouse Fbxw7 protein, His & T7-tagged | +Inquiry |
FBXW7-1496R | Recombinant Rhesus Macaque FBXW7 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXW7-3975H | Recombinant Human FBXW7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXW7-6283HCL | Recombinant Human FBXW7 293 Cell Lysate | +Inquiry |
FBXW7-6282HCL | Recombinant Human FBXW7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXW7 Products
Required fields are marked with *
My Review for All FBXW7 Products
Required fields are marked with *
0
Inquiry Basket