Recombinant Full Length Human FCER2 Protein
| Cat.No. : | FCER2-4730HF |
| Product Overview : | Human FCER2 full-length ORF (NP_001993.2) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 348 amino acids |
| Description : | The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011] |
| Form : | Liquid |
| Molecular Mass : | 36.5 kDa |
| AA Sequence : | MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH 8.0 containing 2% glycerol. |
| Gene Name | FCER2 Fc fragment of IgE, low affinity II, receptor for (CD23) [ Homo sapiens ] |
| Official Symbol | FCER2 |
| Synonyms | FCER2; Fc fragment of IgE, low affinity II, receptor for (CD23); CD23A, Fc fragment of IgE, low affinity II, receptor for (CD23A) , FCE2; low affinity immunoglobulin epsilon Fc receptor; CD23; CLEC4J; BLAST-2; CD23 antigen; fc-epsilon-RII; lymphocyte IgE receptor; immunoglobulin E-binding factor; C-type lectin domain family 4, member J; FCE2; CD23A; IGEBF; |
| Gene ID | 2208 |
| mRNA Refseq | NM_001207019 |
| Protein Refseq | NP_001193948 |
| MIM | 151445 |
| UniProt ID | P06734 |
| ◆ Recombinant Proteins | ||
| FCER2-27296TH | Recombinant Human FCER2 protein(48-248aa), GST-tagged | +Inquiry |
| FCER2-4730HF | Recombinant Full Length Human FCER2 Protein | +Inquiry |
| FCER2-031H | Recombinant Human FCER2 Protein, His-tagged | +Inquiry |
| FCER2-3984H | Recombinant Human FCER2 Protein | +Inquiry |
| FCER2-3811H | Recombinant Human FCER2 protein(48-248aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCER2-1814HCL | Recombinant Human FCER2 cell lysate | +Inquiry |
| FCER2-1023RCL | Recombinant Rat FCER2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCER2 Products
Required fields are marked with *
My Review for All FCER2 Products
Required fields are marked with *
