Recombinant Full Length Human FEM1B Protein, C-Flag-tagged
Cat.No. : | FEM1B-15HFL |
Product Overview : | Recombinant Full Length Human FEM1B Protein, fused to Flag-tag at C-terminus, was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag |
Description : | This gene encodes an ankyrin repeat protein that belongs to the death receptor-associated family of proteins and plays a role in mediating apoptosis. The encoded protein is also thought to function in the replication stress-induced checkpoint signaling pathway via interaction with checkpoint kinase 1. |
Form : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol. |
Molecular Mass : | 70.1 kDa |
AA Sequence : | MEGLAGYVYKAASEGKVLTLAALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGHAKVVRLLLEHYRVQTQQTGTVRFDGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVTNSTPLRAACFDGRLDIVKYLVENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQRADPNAKAHCGATALHFAAEAGHIDIVKELIKWRAAIVVNGHGMTPLKVAAESCKADVVELLLSHADCDRRSRIEALELLGASFANDRENYDIIKTYHYLYLAMLERFQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIYRGAVYADNMEFEQCIKLWLHALHLRQKGNRNTHKDLLRFAQVFSQMIHLNETVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHLAVNSNTPVDDFHTNDVCSFPNALVTKLLLDCGAEVNAVDNEGNSALHIIVQYNRPISDFLTLHSIIISLVEAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEEFVGFH myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage : | Store at -80 centigrade. |
Concentration : | >0.05 μg/μL as determined by microplate BCA method. |
Use/Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Full Length : | Full L. |
Gene Name | FEM1B fem-1 homolog B [ Homo sapiens (human) ] |
Official Symbol | FEM1B |
Synonyms | FEM1B; fem-1 homolog B; F1A-ALPHA; F1AA; FEM1-beta |
Gene ID | 10116 |
mRNA Refseq | NM_015322.5 |
Protein Refseq | NP_056137.1 |
MIM | 613539 |
UniProt ID | Q9UK73 |
◆ Recombinant Proteins | ||
FEM1B-2267C | Recombinant Chicken FEM1B | +Inquiry |
FEM1B-15HFL | Recombinant Full Length Human FEM1B Protein, C-Flag-tagged | +Inquiry |
FEM1B-6415H | Recombinant Human FEM1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FEM1B-5811M | Recombinant Mouse FEM1B Protein | +Inquiry |
FEM1B-1970R | Recombinant Rat FEM1B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FEM1B-6266HCL | Recombinant Human FEM1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FEM1B Products
Required fields are marked with *
My Review for All FEM1B Products
Required fields are marked with *
0
Inquiry Basket