Recombinant Full Length Human FFAR2 Protein

Cat.No. : FFAR2-4798HF
Product Overview : Human FFAR2 full-length ORF (NP_005297.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 254 amino acids
Description : This gene encodes a member of the GP40 family of G protein-coupled receptors that are clustered together on chromosome 19. The encoded protein is a receptor for short chain free fatty acids and may be involved in the inflammatory response and in regulating lipid plasma levels. [provided by RefSeq
Form : Liquid
Molecular Mass : 37.1 kDa
AA Sequence : MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FFAR2 free fatty acid receptor 2 [ Homo sapiens ]
Official Symbol FFAR2
Synonyms FFA2R; GPR43; Free Fatty Acid Receptor 2; G-Protein Coupled Receptor 43; GPR43; Free Fatty Acid Activated Receptor 2; G Protein-Coupled Receptor 43; Fatty Acid Receptor 2; GPCR43; FFA2R; FFA2; free fatty acid receptor 2
Gene ID 2867
mRNA Refseq NM_005306
Protein Refseq NP_005297
MIM 603823
UniProt ID O15552

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FFAR2 Products

Required fields are marked with *

My Review for All FFAR2 Products

Required fields are marked with *

0
cart-icon
0
compare icon