Recombinant Full Length Human FKBP10 Protein, C-Flag-tagged
Cat.No. : | FKBP10-482HFL |
Product Overview : | Recombinant Full Length Human FKBP10 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. This protein localizes to the endoplasmic reticulum and acts as a molecular chaperone. Alternatively spliced variants encoding different isoforms have been reported, but their biological validity has not been determined |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 64.1 kDa |
AA Sequence : | MFPAGPPSHSLLRLPLLQLLLLVVQAVGRGLGRASPAGGPLEDVVIERYHIPRACPREVQMGDFVRYHYN GTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVPPHLGYGSIGLAGLIPPDATL YFDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDGDFVRYHYNGTLLDGTSFDTSYSKGGTYDTYVGSGWL IKGMDQGLLGMCPGERRKIIIPPFLAYGEKGYGTVIPPQASLVFHVLLIDVHNPKDAVQLETLELPPGCV RRAGAGDFMRYHYNGSLMDGTLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACMGERRRITIPPHLAYG ENGTGDKIPGSAVLIFNVHVIDFHNPADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSH DYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEVELVSREDGLP TGYLFVWHKDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPGQDPEKTIGDMFQNQDRNQDG KITVDELKLKSDEDEERVHEELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | FKBP10 FKBP prolyl isomerase 10 [ Homo sapiens (human) ] |
Official Symbol | FKBP10 |
Synonyms | OI6; OI11; BRKS1; FKBP65; PPIASE; hFKBP65 |
Gene ID | 60681 |
mRNA Refseq | NM_021939.4 |
Protein Refseq | NP_068758.3 |
MIM | 607063 |
UniProt ID | Q96AY3 |
◆ Recombinant Proteins | ||
Fkbp10-1290M | Recombinant Mouse Fkbp10 protein, His-tagged | +Inquiry |
FKBP10-58H | Recombinant Human FKBP10 Protein, Myc/DDK-tagged | +Inquiry |
FKBP10-1716R | Recombinant Rhesus monkey FKBP10 Protein, His-tagged | +Inquiry |
FKBP10-1289H | Recombinant Human FKBP10 protein, His-tagged | +Inquiry |
FKBP10-1538R | Recombinant Rhesus Macaque FKBP10 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP10-6213HCL | Recombinant Human FKBP10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP10 Products
Required fields are marked with *
My Review for All FKBP10 Products
Required fields are marked with *
0
Inquiry Basket