Recombinant Full Length Human FKBP5 Protein, GST-tagged
Cat.No. : | FKBP5-6932HF |
Product Overview : | Recombinant Human full-length FKBP5(1 a.a. - 457 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 457 amino acids |
Description : | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 76.01 kDa |
AA Sequence : | MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNE PFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIR RTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGF GEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE KVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEE EKPEGHV |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FKBP5 FKBP prolyl isomerase 5 [ Homo sapiens (human) ] |
Official Symbol | FKBP5 |
Synonyms | FKBP5; FK506 binding protein 5; P54; AIG6; FKBP51; FKBP54; PPIase; Ptg-10; MGC111006; peptidyl-prolyl cis-trans isomerase FKBP5; FKBP-5; FKBP-51; rotamase; 51 kDa FKBP; FF1 antigen; PPIase FKBP5; HSP90-binding immunophilin; T-cell FK506-binding protein; androgen-regulated protein 6; 51 kDa FK506-binding protein 5; peptidylprolyl cis-trans isomerase; 54 kDa progesterone receptor-associated immunophilin; EC 5.2.1.8; PPIase FKBP5; OTTHUMP00000016268 |
Gene ID | 2289 |
mRNA Refseq | NM_001145775 |
Protein Refseq | NP_001139247 |
MIM | 602623 |
UniProt ID | Q13451 |
◆ Recombinant Proteins | ||
FKBP5-2124H | Recombinant Human FKBP5 protein, His-tagged | +Inquiry |
FKBP5-6932HF | Recombinant Full Length Human FKBP5 Protein, GST-tagged | +Inquiry |
FKBP5-2794H | Recombinant Human FKBP5 Protein (Met1-Glu375), N-His tagged | +Inquiry |
Fkbp5-1268M | Recombinant Mouse Fkbp5 protein, His-tagged | +Inquiry |
FKBP5-12365Z | Recombinant Zebrafish FKBP5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP5-6204HCL | Recombinant Human FKBP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP5 Products
Required fields are marked with *
My Review for All FKBP5 Products
Required fields are marked with *