Recombinant Full Length Human FLOT1 Protein, C-Flag-tagged
Cat.No. : | FLOT1-202HFL |
Product Overview : | Recombinant Full Length Human FLOT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an protein that localizes to the caveolae, which are small domains on the inner cell membranes. This protein plays a role in vesicle trafficking and cell morphology. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 47.2 kDa |
AA Sequence : | MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQ VKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLV NMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMA KAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELE ARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQE AAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVN HKPLRTATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Insulin signaling pathway |
Full Length : | Full L. |
Gene Name | FLOT1 flotillin 1 [ Homo sapiens (human) ] |
Official Symbol | FLOT1 |
Synonyms | flotillin 1; integral membrane component of caveolae; OTTHUMP00000029208 |
Gene ID | 10211 |
mRNA Refseq | NM_005803.4 |
Protein Refseq | NP_005794.1 |
MIM | 606998 |
UniProt ID | O75955 |
◆ Recombinant Proteins | ||
Flot1-3039M | Recombinant Mouse Flot1 Protein, Myc/DDK-tagged | +Inquiry |
FLOT1-3434H | Recombinant Human FLOT1 protein(149-427aa), His-tagged | +Inquiry |
FLOT1-202HFL | Recombinant Full Length Human FLOT1 Protein, C-Flag-tagged | +Inquiry |
Flot1-1505R | Recombinant Rat Flot1 Protein, His-tagged | +Inquiry |
FLOT1-920H | Recombinant Human FLOT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLOT1-6186HCL | Recombinant Human FLOT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLOT1 Products
Required fields are marked with *
My Review for All FLOT1 Products
Required fields are marked with *
0
Inquiry Basket