Recombinant Full Length Human FLRT2 Protein, C-Flag-tagged
Cat.No. : | FLRT2-70HFL |
Product Overview : | Recombinant Full Length Human FLRT2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the fibronectin leucine rich transmembrane (FLRT) family of cell adhesion molecules, which regulate early embryonic vascular and neural development. The encoded type I transmembrane protein has an extracellular region consisting of an N-terminal leucine-rich repeat domain and a type 3 fibronectin domain, followed by a transmembrane domain and a short C-terminal cytoplasmic tail domain. It functions as both a homophilic cell adhesion molecule and a heterophilic chemorepellent through its interaction with members of the uncoordinated-5 receptor family. Proteolytic removal of the extracellular region controls the migration of neurons in the developing cortex. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 73.9 kDa |
AA Sequence : | MGLQTTKWPSHGAFFLKSWLIISLGLYSQVSKLLACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYL HNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENNIQTISRAALAQLLKLEELHL DDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAVISDMAFQNLTSLERLI VDGNLLTNKGIAEGTFSHLTKLKEFSIVRNSLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLER LDISNNQLRMLTQGVFDNLSNLKQLTARNNPWFCDCSIKWVTEWLKYIPSSLNVRGFMCQGPEQVRGMAV RELNMNLLSCPTTTPGLPLFTPAPSTASPTTQPPTLSIPNPSRSYTPPTPTTSKLPTIPDWDGRERVTPP ISERIQLSIHFVNDTSIQVSWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSLVNLEPRSTYR ICLVPLDAFNYRAVEDTICSEATTHASYLNNGSNTASSHEQTTSHSMGSPFLLAGLIGGAVIFVLVVLLS VFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTP NGGINYTDCHIPNNMRYCNSSVPDLEHCHTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | FLRT2 fibronectin leucine rich transmembrane protein 2 [ Homo sapiens (human) ] |
Official Symbol | FLRT2 |
Synonyms | KIAA0405 |
Gene ID | 23768 |
mRNA Refseq | NM_013231.6 |
Protein Refseq | NP_037363.1 |
MIM | 604807 |
UniProt ID | O43155 |
◆ Recombinant Proteins | ||
FLRT2-3892H | Recombinant Human FLRT2, His tagged | +Inquiry |
FLRT2-70HFL | Recombinant Full Length Human FLRT2 Protein, C-Flag-tagged | +Inquiry |
FLRT2-3489H | Recombinant Human FLRT2 Protein (Cys36-Ser539), C-His tagged | +Inquiry |
FLRT2-922H | Recombinant Human FLRT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FLRT2-2342H | Recombinant Human FLRT2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLRT2-1944HCL | Recombinant Human FLRT2 cell lysate | +Inquiry |
FLRT2-1056MCL | Recombinant Mouse FLRT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLRT2 Products
Required fields are marked with *
My Review for All FLRT2 Products
Required fields are marked with *
0
Inquiry Basket