Recombinant Full Length Human FNDC4 Protein, GST-tagged
| Cat.No. : | FNDC4-5007HF |
| Product Overview : | Human FNDC4 full-length ORF ( NP_073734.1, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 234 amino acids |
| Description : | FNDC4 (Fibronectin Type III Domain Containing 4) is a Protein Coding gene. An important paralog of this gene is FNDC5. |
| Molecular Mass : | 51.6 kDa |
| AA Sequence : | MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FNDC4 fibronectin type III domain containing 4 [ Homo sapiens ] |
| Official Symbol | FNDC4 |
| Synonyms | FNDC4; fibronectin type III domain containing 4; fibronectin type III domain-containing protein 4; FLJ22362; FRCP1; fibronectin type III repeat-containing protein 1; |
| Gene ID | 64838 |
| mRNA Refseq | NM_022823 |
| Protein Refseq | NP_073734 |
| MIM | 611905 |
| UniProt ID | Q9H6D8 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FNDC4 Products
Required fields are marked with *
My Review for All FNDC4 Products
Required fields are marked with *
Recently Viewed
