Recombinant Full Length Human FNDC4 Protein, GST-tagged
| Cat.No. : | FNDC4-5007HF | 
| Product Overview : | Human FNDC4 full-length ORF ( NP_073734.1, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 234 amino acids | 
| Description : | FNDC4 (Fibronectin Type III Domain Containing 4) is a Protein Coding gene. An important paralog of this gene is FNDC5. | 
| Molecular Mass : | 51.6 kDa | 
| AA Sequence : | MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | FNDC4 fibronectin type III domain containing 4 [ Homo sapiens ] | 
| Official Symbol | FNDC4 | 
| Synonyms | FNDC4; fibronectin type III domain containing 4; fibronectin type III domain-containing protein 4; FLJ22362; FRCP1; fibronectin type III repeat-containing protein 1; | 
| Gene ID | 64838 | 
| mRNA Refseq | NM_022823 | 
| Protein Refseq | NP_073734 | 
| MIM | 611905 | 
| UniProt ID | Q9H6D8 | 
| ◆ Recombinant Proteins | ||
| FNDC4-5007HF | Recombinant Full Length Human FNDC4 Protein, GST-tagged | +Inquiry | 
| FNDC4-121H | Recombinant Human FNDC4 protein, T7/His-tagged | +Inquiry | 
| FNDC4-4330H | Recombinant Human FNDC4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| FNDC4-929H | Recombinant Human FNDC4 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Fndc4-3064M | Recombinant Mouse Fndc4 Protein, Myc/DDK-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| FNDC4-6173HCL | Recombinant Human FNDC4 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FNDC4 Products
Required fields are marked with *
My Review for All FNDC4 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            