Recombinant Full Length Human FNDC9 Protein, GST-tagged

• Cat.No.: FNDC9-3918HF
• Product Overview: Human C5orf40 full-length ORF ( NP_001001343.1, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 224 amino acids
• Description: FNDC9 (Fibronectin Type III Domain Containing 9) is a Protein Coding gene.
• Molecular Mass: 51.7 kDa
• AA Sequence: MNIEVGNISYTGAIISWSSSEPCLEDYYHIMYRPNWNSIFSGYLRYSFHNEEKVPRTISSVVLEHLAPSTLYFLCISCKKAAFPYRHYCTMFHTLDKSPLAPGSSLVDPQISLWVLMAILLACFTAVLAFICLQFWCVRCHEPRWSYRAGHMEEANGLVRWPEEAPDLGQREEDLQGLPLVEMPRKNSRDGAELDPEANQDAPDAGALQRGGGDPPAILPHCGE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FNDC9 fibronectin type III domain containing 9 [ Homo sapiens (human) ]
• Official Symbol: FNDC9
• Synonyms: C5orf40; FNDC9; fibronectin type III domain containing 9; fibronectin type III domain-containing protein 9; fibronectin type-III domain-containing protein C5orf40
• Gene ID: 408263
• mRNA Refseq: NM_001001343
• Protein Refseq: NP_001001343
• UniProt ID: Q8TBE3