Recombinant Full Length Human FNTB Protein, C-Flag-tagged
Cat.No. : | FNTB-1431HFL |
Product Overview : | Recombinant Full Length Human FNTB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables zinc ion binding activity. Contributes to protein farnesyltransferase activity. Involved in protein farnesylation. Part of microtubule associated complex and protein farnesyltransferase complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 48.6 kDa |
AA Sequence : | MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPR LVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGF GGGPGQYPHLAPTYAAVNALCIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASV ASLTNIITPDLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSR QMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGL LDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPVYNIGPDKVIQATTYFLQKPV PGFEELKDETSAEPATDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | FNTB farnesyltransferase, CAAX box, beta [ Homo sapiens (human) ] |
Official Symbol | FNTB |
Synonyms | FPTB |
Gene ID | 2342 |
mRNA Refseq | NM_002028.4 |
Protein Refseq | NP_002019.1 |
MIM | 134636 |
UniProt ID | P49356 |
◆ Recombinant Proteins | ||
FNTB-1431HFL | Recombinant Full Length Human FNTB Protein, C-Flag-tagged | +Inquiry |
FNTB-5965M | Recombinant Mouse FNTB Protein | +Inquiry |
FNTB-3982H | Recombinant Human FNTB Protein, Myc/DDK-tagged | +Inquiry |
FNTB-1557R | Recombinant Rhesus Macaque FNTB Protein, His (Fc)-Avi-tagged | +Inquiry |
FNTB-2378R | Recombinant Rat FNTB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FNTB-6170HCL | Recombinant Human FNTB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FNTB Products
Required fields are marked with *
My Review for All FNTB Products
Required fields are marked with *
0
Inquiry Basket