Recombinant Full Length Human FOXA3 Protein, GST-tagged

Cat.No. : FOXA3-5047HF
Product Overview : Human FOXA3 full-length ORF ( NP_004488.2, 1 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 350 amino acids
Description : This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq
Molecular Mass : 63.5 kDa
AA Sequence : MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FOXA3 forkhead box A3 [ Homo sapiens ]
Official Symbol FOXA3
Synonyms FOXA3; forkhead box A3; hepatocyte nuclear factor 3, gamma, HNF3G; hepatocyte nuclear factor 3-gamma; HNF-3G; TCF-3G; HNF-3-gamma; forkhead box protein A3; transcription factor 3G; fork head-related protein FKH H3; hepatocyte nuclear factor 3, gamma; FKHH3; HNF3G; TCF3G; MGC10179;
Gene ID 3171
mRNA Refseq NM_004497
Protein Refseq NP_004488
MIM 602295
UniProt ID P55318

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXA3 Products

Required fields are marked with *

My Review for All FOXA3 Products

Required fields are marked with *

0
cart-icon