Recombinant Full Length Human FOXA3 Protein, GST-tagged
Cat.No. : | FOXA3-5047HF |
Product Overview : | Human FOXA3 full-length ORF ( NP_004488.2, 1 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 350 amino acids |
Description : | This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq |
Molecular Mass : | 63.5 kDa |
AA Sequence : | MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOXA3 forkhead box A3 [ Homo sapiens ] |
Official Symbol | FOXA3 |
Synonyms | FOXA3; forkhead box A3; hepatocyte nuclear factor 3, gamma, HNF3G; hepatocyte nuclear factor 3-gamma; HNF-3G; TCF-3G; HNF-3-gamma; forkhead box protein A3; transcription factor 3G; fork head-related protein FKH H3; hepatocyte nuclear factor 3, gamma; FKHH3; HNF3G; TCF3G; MGC10179; |
Gene ID | 3171 |
mRNA Refseq | NM_004497 |
Protein Refseq | NP_004488 |
MIM | 602295 |
UniProt ID | P55318 |
◆ Recombinant Proteins | ||
Foxa3-1512M | Recombinant Mouse Foxa3 Protein, His-tagged | +Inquiry |
FOXA3-5047HF | Recombinant Full Length Human FOXA3 Protein, GST-tagged | +Inquiry |
FOXA3-4435H | Recombinant Human FOXA3 Protein, GST-tagged | +Inquiry |
FOXA3-1511H | Recombinant Human FOXA3 Protein, His-tagged | +Inquiry |
FOXA3-2384R | Recombinant Rat FOXA3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXA3-662HCL | Recombinant Human FOXA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXA3 Products
Required fields are marked with *
My Review for All FOXA3 Products
Required fields are marked with *