Recombinant Full Length Human FOXO3 Protein, C-Flag-tagged
Cat.No. : | FOXO3-1674HFL |
Product Overview : | Recombinant Full Length Human FOXO3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 71.1 kDa |
AA Sequence : | MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGG GRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGA AGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSI RHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPES ADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSS SASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSD PLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLS ESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRS ELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Protein Pathways : | Chemokine signaling pathway, Endometrial cancer, Neurotrophin signaling pathway, Non-small cell lung cancer |
Full Length : | Full L. |
Gene Name | FOXO3 forkhead box O3 [ Homo sapiens (human) ] |
Official Symbol | FOXO3 |
Synonyms | FOXO2; AF6q21; FKHRL1; FOXO3A; FKHRL1P2 |
Gene ID | 2309 |
mRNA Refseq | NM_201559.3 |
Protein Refseq | NP_963853.1 |
MIM | 602681 |
UniProt ID | O43524 |
◆ Recombinant Proteins | ||
FOXO3-2928H | Recombinant Human FOXO3 protein, His-SUMO-tagged | +Inquiry |
FOXO3-2811H | Recombinant Human FOXO3, MYC/DDK-tagged | +Inquiry |
FOXO3-7633H | Recombinant Human FOXO3 protein, His & T7-tagged | +Inquiry |
FOXO3-2787H | Recombinant Human FOXO3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FOXO3-7008HFL | Recombinant Full Length Human FOXO3, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXO3-6148HCL | Recombinant Human FOXO3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOXO3 Products
Required fields are marked with *
My Review for All FOXO3 Products
Required fields are marked with *
0
Inquiry Basket