Recombinant Full Length Human FOXR2 Protein, GST-tagged

Cat.No. : FOXR2-5112HF
Product Overview : Human FOXR2 full-length ORF ( AAH12934, 1 a.a. - 311 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 311 amino acids
Description : FOXR2 (Forkhead Box R2) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is FOXR1.
Molecular Mass : 59.95 kDa
AA Sequence : MDLKLKDCEFWYSLHGQVPGLLDWDMRNELFLPCTTDQCSLAEQILAKYRVGVMKPPEMPQKRRPSPDGDGPPCEPNLWMWVDPNILCPLGSQEAPKPSGKEDLTNISPFPQPPQKDEGSNCSEDKVVESLPSSSSEQSPLQKQGIHSPSDFELTEEEAEEPDDNSLQSPEMKCYQSQKLWQINNQEKSWQRPPLNCSHLIALALRNNPHCGLSVQEIYNFTRQHFPFFWTAPDGWKSTIHYNLCFLDSFEKVPDSLKDEDNARPRSCLWKLTKEGHRRFWEETRVLAFAQRERIQECMSQPELLTSLFDL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FOXR2 forkhead box R2 [ Homo sapiens ]
Official Symbol FOXR2
Synonyms FOXR2; forkhead box R2; forkhead box protein R2; FOXN6; MGC21658; forkhead box protein N6;
Gene ID 139628
mRNA Refseq NM_198451
Protein Refseq NP_940853
MIM 300949
UniProt ID Q6PJQ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXR2 Products

Required fields are marked with *

My Review for All FOXR2 Products

Required fields are marked with *

0
cart-icon
0
compare icon