Recombinant Full Length Human FOXR2 Protein, GST-tagged
Cat.No. : | FOXR2-5112HF |
Product Overview : | Human FOXR2 full-length ORF ( AAH12934, 1 a.a. - 311 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 311 amino acids |
Description : | FOXR2 (Forkhead Box R2) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is FOXR1. |
Molecular Mass : | 59.95 kDa |
AA Sequence : | MDLKLKDCEFWYSLHGQVPGLLDWDMRNELFLPCTTDQCSLAEQILAKYRVGVMKPPEMPQKRRPSPDGDGPPCEPNLWMWVDPNILCPLGSQEAPKPSGKEDLTNISPFPQPPQKDEGSNCSEDKVVESLPSSSSEQSPLQKQGIHSPSDFELTEEEAEEPDDNSLQSPEMKCYQSQKLWQINNQEKSWQRPPLNCSHLIALALRNNPHCGLSVQEIYNFTRQHFPFFWTAPDGWKSTIHYNLCFLDSFEKVPDSLKDEDNARPRSCLWKLTKEGHRRFWEETRVLAFAQRERIQECMSQPELLTSLFDL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOXR2 forkhead box R2 [ Homo sapiens ] |
Official Symbol | FOXR2 |
Synonyms | FOXR2; forkhead box R2; forkhead box protein R2; FOXN6; MGC21658; forkhead box protein N6; |
Gene ID | 139628 |
mRNA Refseq | NM_198451 |
Protein Refseq | NP_940853 |
MIM | 300949 |
UniProt ID | Q6PJQ5 |
◆ Recombinant Proteins | ||
FOXR2-5112HF | Recombinant Full Length Human FOXR2 Protein, GST-tagged | +Inquiry |
FOXR2-6016M | Recombinant Mouse FOXR2 Protein | +Inquiry |
FOXR2-4480H | Recombinant Human FOXR2 Protein, GST-tagged | +Inquiry |
FOXR2-12990H | Recombinant Human FOXR2, GST-tagged | +Inquiry |
FOXR2-078H | Recombinant Human FOXR2 Protein, HIS-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXR2-6142HCL | Recombinant Human FOXR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXR2 Products
Required fields are marked with *
My Review for All FOXR2 Products
Required fields are marked with *