Recombinant Full Length Human FOXS1 Protein, GST-tagged

Cat.No. : FOXS1-4825HF
Product Overview : Human FKHL18 full-length ORF ( NP_004109.1, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 330 amino acids
Description : The forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded protein is unknown. [provided by RefSeq
Molecular Mass : 61.8 kDa
AA Sequence : MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FOXS1 forkhead box S1 [ Homo sapiens ]
Official Symbol FOXS1
Synonyms FOXS1; forkhead box S1; FKHL18, forkhead (Drosophila) like 18, forkhead like 18 (Drosophila); forkhead box protein S1; FREAC10; FREAC-10; forkhead-like 18 protein; forkhead-related activator 10; forkhead-related transcription factor 10; forkhead-related transcription factor FREAC-10; FKHL18; MGC4544;
Gene ID 2307
mRNA Refseq NM_004118
Protein Refseq NP_004109
MIM 602939
UniProt ID O43638

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXS1 Products

Required fields are marked with *

My Review for All FOXS1 Products

Required fields are marked with *

0
cart-icon