Recombinant Full Length Human FSTL1 Protein, C-Flag-tagged
Cat.No. : | FSTL1-1992HFL |
Product Overview : | Recombinant Full Length Human FSTL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 10 conserved cysteine residues. This gene product is thought to be an autoantigen associated with rheumatoid arthritis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.6 kDa |
AA Sequence : | MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELRRRIIQWLEAEIIPDGWFS KGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENAD WKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTE EEMTRYVQELQKHQETAEKTKRVSTKEI myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | FSTL1 follistatin like 1 [ Homo sapiens (human) ] |
Official Symbol | FSTL1 |
Synonyms | FRP; FSL1; OCC1; OCC-1; tsc36; MIR198 |
Gene ID | 11167 |
mRNA Refseq | NM_007085.5 |
Protein Refseq | NP_009016.1 |
MIM | 605547 |
UniProt ID | Q12841 |
◆ Recombinant Proteins | ||
FSTL1-4525H | Recombinant Human FSTL1 Protein, GST-tagged | +Inquiry |
FSTL1-2399R | Recombinant Rat FSTL1 Protein | +Inquiry |
FSTL1-3458H | Recombinant Human FSTL1 Protein (Glu21-Ile308) | +Inquiry |
FSTL1-2833H | Recombinant Human FSTL1 protein(151-300 aa), C-His-tagged | +Inquiry |
FSTL1-1755R | Recombinant Rhesus monkey FSTL1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FSTL1-001MCL | Recombinant Mouse FSTL1 cell lysate | +Inquiry |
FSTL1-2679HCL | Recombinant Human FSTL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FSTL1 Products
Required fields are marked with *
My Review for All FSTL1 Products
Required fields are marked with *
0
Inquiry Basket