Recombinant Full Length Human FSTL4 Protein, GST-tagged

Cat.No. : FSTL4-5117HF
Product Overview : Human FSTL4 full-length ORF ( AAH24300.1, 1 a.a. - 605 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 605 amino acids
Description : FSTL4 (Follistatin Like 4) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is FSTL5.
Molecular Mass : 93.6 kDa
AA Sequence : MKPGGFWLHLTLLGASLPAALGWMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNELLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGSDGRFYENHCKLHRAACLLGKRITVIHSKDCFLKGDTCTMAGYARLKNVLLALQTRLQPLQEGDSRQDPASQKRLLVESLFRDLDADGNGHLSSSELAQHVLKKQDLDEDLLGCSPGDLLRFDDYNSDSSLTLREFYIAFQVVQLSLAPEDRVSVTTVTVGLSTVLTCAVHGDLRPPIIWKRNGLTLNFLDLEDINDFGEDDSLYITKVTTIHMGNYTCHASGHEQLFQTHVLQVNVPPVIRVYPESQAQEPGVAASLRCHAEGIPMPRITWLKNGVDVSTQMSKQLSLLANGSELHISSVRYEDTGAYTCIAKNEVGVDEDISSLFIEDSARKTLANILWREEGLSVGNMFYVFSDDGIIVIHPVDCEIQRHLKPTEKIFMSYEEICPQREKNATQPCQWVSAVNVRNRYIYVAQPALSRVLVVDIQAQKVLQSIGVDPLPAKLSYDKSHDQVWVLSWGDVHKSRPSLQVITEASTGQSQHLIRTPFAGVDDFFIPPINLEQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FSTL4 follistatin-like 4 [ Homo sapiens ]
Official Symbol FSTL4
Synonyms FSTL4; follistatin-like 4; follistatin-related protein 4; KIAA1061; follistatin-like protein 4;
Gene ID 23105
mRNA Refseq NM_015082
Protein Refseq NP_055897
UniProt ID Q6MZW2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FSTL4 Products

Required fields are marked with *

My Review for All FSTL4 Products

Required fields are marked with *

0
cart-icon
0
compare icon