Recombinant Full Length Human FSTL4 Protein, GST-tagged
Cat.No. : | FSTL4-5117HF |
Product Overview : | Human FSTL4 full-length ORF ( AAH24300.1, 1 a.a. - 605 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 605 amino acids |
Description : | FSTL4 (Follistatin Like 4) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is FSTL5. |
Molecular Mass : | 93.6 kDa |
AA Sequence : | MKPGGFWLHLTLLGASLPAALGWMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNELLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGSDGRFYENHCKLHRAACLLGKRITVIHSKDCFLKGDTCTMAGYARLKNVLLALQTRLQPLQEGDSRQDPASQKRLLVESLFRDLDADGNGHLSSSELAQHVLKKQDLDEDLLGCSPGDLLRFDDYNSDSSLTLREFYIAFQVVQLSLAPEDRVSVTTVTVGLSTVLTCAVHGDLRPPIIWKRNGLTLNFLDLEDINDFGEDDSLYITKVTTIHMGNYTCHASGHEQLFQTHVLQVNVPPVIRVYPESQAQEPGVAASLRCHAEGIPMPRITWLKNGVDVSTQMSKQLSLLANGSELHISSVRYEDTGAYTCIAKNEVGVDEDISSLFIEDSARKTLANILWREEGLSVGNMFYVFSDDGIIVIHPVDCEIQRHLKPTEKIFMSYEEICPQREKNATQPCQWVSAVNVRNRYIYVAQPALSRVLVVDIQAQKVLQSIGVDPLPAKLSYDKSHDQVWVLSWGDVHKSRPSLQVITEASTGQSQHLIRTPFAGVDDFFIPPINLEQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FSTL4 follistatin-like 4 [ Homo sapiens ] |
Official Symbol | FSTL4 |
Synonyms | FSTL4; follistatin-like 4; follistatin-related protein 4; KIAA1061; follistatin-like protein 4; |
Gene ID | 23105 |
mRNA Refseq | NM_015082 |
Protein Refseq | NP_055897 |
UniProt ID | Q6MZW2 |
◆ Recombinant Proteins | ||
FSTL4-217H | Recombinant Human FSTL4 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
FSTL4-688H | Active Recombinant Human FSTL4 Protein, His-tagged | +Inquiry |
FSTL4-563H | Active Recombinant Human Follistatin-Like 4, His-tagged | +Inquiry |
FSTL4-3375Z | Recombinant Zebrafish FSTL4 | +Inquiry |
FSTL4-13021H | Recombinant Human FSTL4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FSTL4-674HCL | Recombinant Human FSTL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FSTL4 Products
Required fields are marked with *
My Review for All FSTL4 Products
Required fields are marked with *
0
Inquiry Basket