Recombinant Full Length Human FUT7 Protein, GST-tagged

Cat.No. : FUT7-5195HF
Product Overview : Human FUT9 full-length ORF ( AAH36101.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 359 amino acids
Description : The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X antigens. The encoded protein can direct the synthesis of the E-selectin-binding sialyl-Lewis X moiety. [provided by RefSeq
Molecular Mass : 34.65 kDa
AA Sequence : YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FUT7 fucosyltransferase 7 (alpha (1,3) fucosyltransferase) [ Homo sapiens ]
Official Symbol FUT7
Synonyms FUT7; fucosyltransferase 7 (alpha (1,3) fucosyltransferase); alpha-(1,3)-fucosyltransferase; fuc-TVII; fucosyltransferase VII; selectin ligand synthase; selectin-ligand synthase; galactoside 3-L-fucosyltransferase; FucT-VII;
Gene ID 2529
mRNA Refseq NM_004479
Protein Refseq NP_004470
MIM 602030
UniProt ID Q11130

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FUT7 Products

Required fields are marked with *

My Review for All FUT7 Products

Required fields are marked with *

0
cart-icon