Recombinant Full Length Human FUT7 Protein, GST-tagged
Cat.No. : | FUT7-5195HF |
Product Overview : | Human FUT9 full-length ORF ( AAH36101.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 359 amino acids |
Description : | The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X antigens. The encoded protein can direct the synthesis of the E-selectin-binding sialyl-Lewis X moiety. [provided by RefSeq |
Molecular Mass : | 34.65 kDa |
AA Sequence : | YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FUT7 fucosyltransferase 7 (alpha (1,3) fucosyltransferase) [ Homo sapiens ] |
Official Symbol | FUT7 |
Synonyms | FUT7; fucosyltransferase 7 (alpha (1,3) fucosyltransferase); alpha-(1,3)-fucosyltransferase; fuc-TVII; fucosyltransferase VII; selectin ligand synthase; selectin-ligand synthase; galactoside 3-L-fucosyltransferase; FucT-VII; |
Gene ID | 2529 |
mRNA Refseq | NM_004479 |
Protein Refseq | NP_004470 |
MIM | 602030 |
UniProt ID | Q11130 |
◆ Recombinant Proteins | ||
FUT7-131H | Recombinant Human FUT7, His-tagged | +Inquiry |
Fut7-4263M | Recombinant Mouse Fut7 protein, His-tagged | +Inquiry |
FUT7-3515Z | Recombinant Zebrafish FUT7 | +Inquiry |
FUT7-4566H | Recombinant Human FUT7 Protein, GST-tagged | +Inquiry |
FUT7-01H | Active Recombinant Human FUT7 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUT7-6112HCL | Recombinant Human FUT7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUT7 Products
Required fields are marked with *
My Review for All FUT7 Products
Required fields are marked with *