Recombinant Full Length Human Fxyd Domain-Containing Ion Transport Regulator 7(Fxyd7) Protein, His-Tagged
| Cat.No. : | RFL25379HF |
| Product Overview : | Recombinant Full Length Human FXYD domain-containing ion transport regulator 7(FXYD7) Protein (P58549) (1-80aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-80) |
| Form : | Lyophilized powder |
| AA Sequence : | MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSES PTCKSCKSELPSSAPGGGGV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | FXYD7 |
| Synonyms | FXYD7; FXYD domain-containing ion transport regulator 7 |
| UniProt ID | P58549 |
| ◆ Recombinant Proteins | ||
| Fxyd7-3116M | Recombinant Mouse Fxyd7 Protein, Myc/DDK-tagged | +Inquiry |
| RFL13676RF | Recombinant Full Length Rat Fxyd Domain-Containing Ion Transport Regulator 7(Fxyd7) Protein, His-Tagged | +Inquiry |
| FXYD7-13060H | Recombinant Human FXYD7 protein, GST-tagged | +Inquiry |
| FXYD7-2426R | Recombinant Rat FXYD7 Protein | +Inquiry |
| FXYD7-3405M | Recombinant Mouse FXYD7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FXYD7-6096HCL | Recombinant Human FXYD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FXYD7 Products
Required fields are marked with *
My Review for All FXYD7 Products
Required fields are marked with *



