Recombinant Human FXYD7 protein, GST-tagged
Cat.No. : | FXYD7-13060H |
Product Overview : | Recombinant Human FXYD7 protein(1-80 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-80 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | FXYD7 |
Synonyms | FXYD7; FXYD domain containing ion transport regulator 7; FXYD domain-containing ion transport regulator 7; FLJ25096; |
Gene ID | 53822 |
mRNA Refseq | NM_022006 |
Protein Refseq | NP_071289 |
MIM | 606684 |
UniProt ID | P58549 |
◆ Cell & Tissue Lysates | ||
FXYD7-6096HCL | Recombinant Human FXYD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FXYD7 Products
Required fields are marked with *
My Review for All FXYD7 Products
Required fields are marked with *