Recombinant Full Length Human GABARAPL2 Protein, GST-tagged

Cat.No. : GABARAPL2-5149HF
Product Overview : Human GABARAPL2 full-length ORF (AAH05985.1, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 117 amino acids
Description : GABARAPL2 (GABA Type A Receptor Associated Protein Like 2) is a Protein Coding gene. Diseases associated with GABARAPL2 include Amyotrophic Lateral Sclerosis Type 14 and Neuronal Ceroid Lipofuscinosis. Among its related pathways are Mitophagy - animal and Vesicle-mediated transport. GO annotations related to this gene include microtubule binding and SNARE binding. An important paralog of this gene is GABARAPL1.
Molecular Mass : 39.27 kDa
AA Sequence : MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GABARAPL2 GABA(A) receptor-associated protein-like 2 [ Homo sapiens ]
Official Symbol GABARAPL2
Synonyms GABARAPL2; GABA(A) receptor-associated protein-like 2; gamma-aminobutyric acid receptor-associated protein-like 2; ATG8; ATG8C; GATE 16; GATE16; GEF2; ganglioside expression factor 2; MAP1 light chain 3 related protein; MAP1 light chain 3-related protein; general protein transport factor p16; golgi-associated ATPase enhancer of 16 kDa; GEF-2; GATE-16;
Gene ID 11345
mRNA Refseq NM_007285
Protein Refseq NP_009216
MIM 607452
UniProt ID P60520

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GABARAPL2 Products

Required fields are marked with *

My Review for All GABARAPL2 Products

Required fields are marked with *

0
cart-icon