Recombinant Full Length Human GABARAPL2 Protein, GST-tagged
Cat.No. : | GABARAPL2-5149HF |
Product Overview : | Human GABARAPL2 full-length ORF (AAH05985.1, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 117 amino acids |
Description : | GABARAPL2 (GABA Type A Receptor Associated Protein Like 2) is a Protein Coding gene. Diseases associated with GABARAPL2 include Amyotrophic Lateral Sclerosis Type 14 and Neuronal Ceroid Lipofuscinosis. Among its related pathways are Mitophagy - animal and Vesicle-mediated transport. GO annotations related to this gene include microtubule binding and SNARE binding. An important paralog of this gene is GABARAPL1. |
Molecular Mass : | 39.27 kDa |
AA Sequence : | MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GABARAPL2 GABA(A) receptor-associated protein-like 2 [ Homo sapiens ] |
Official Symbol | GABARAPL2 |
Synonyms | GABARAPL2; GABA(A) receptor-associated protein-like 2; gamma-aminobutyric acid receptor-associated protein-like 2; ATG8; ATG8C; GATE 16; GATE16; GEF2; ganglioside expression factor 2; MAP1 light chain 3 related protein; MAP1 light chain 3-related protein; general protein transport factor p16; golgi-associated ATPase enhancer of 16 kDa; GEF-2; GATE-16; |
Gene ID | 11345 |
mRNA Refseq | NM_007285 |
Protein Refseq | NP_009216 |
MIM | 607452 |
UniProt ID | P60520 |
◆ Recombinant Proteins | ||
GABARAPL2-482H | Recombinant Human BMI1 Protein(1-117aa), GST-tagged | +Inquiry |
GABARAPL2-2991H | Recombinant Human GABARAPL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GABARAPL2-2239H | Recombinant Human GABARAPL2 protein, His-tagged | +Inquiry |
GABARAPL2-2442R | Recombinant Rat GABARAPL2 Protein | +Inquiry |
GABARAPL2-13086H | Recombinant Human GABARAPL2, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GABARAPL2 Products
Required fields are marked with *
My Review for All GABARAPL2 Products
Required fields are marked with *
0
Inquiry Basket