Recombinant Full Length Human GAL Protein, GST-tagged

• Cat.No.: GAL-5218HF
• Product Overview: Human GAL full-length ORF ( AAH30241, 1 a.a. - 123 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 123 amino acids
• Description: Galanin is small neuropeptide that functions as a cellular messenger within the central and peripheral nervous systems, modulating diverse physiologic functions (Mechenthaler, 2008 [PubMed 18500643]).[supplied by OMIM
• Molecular Mass: 39.27 kDa
• AA Sequence: MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GAL galanin prepropeptide [ Homo sapiens ]
• Official Symbol: GAL
• Synonyms: GAL; galanin prepropeptide; galanin, GALN; galanin peptides; galanin message associated peptide; GLNN; GMAP; galanin-related peptide; galanin-message-associated peptide; GALN; MGC40167
• Gene ID: 51083
• mRNA Refseq: NM_015973
• Protein Refseq: NP_057057
• MIM: 137035
• UniProt ID: P22466