Recombinant Full Length Human GAL Protein, GST-tagged
| Cat.No. : | GAL-5218HF |
| Product Overview : | Human GAL full-length ORF ( AAH30241, 1 a.a. - 123 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 123 amino acids |
| Description : | Galanin is small neuropeptide that functions as a cellular messenger within the central and peripheral nervous systems, modulating diverse physiologic functions (Mechenthaler, 2008 [PubMed 18500643]).[supplied by OMIM |
| Molecular Mass : | 39.27 kDa |
| AA Sequence : | MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GAL galanin prepropeptide [ Homo sapiens ] |
| Official Symbol | GAL |
| Synonyms | GAL; galanin prepropeptide; galanin, GALN; galanin peptides; galanin message associated peptide; GLNN; GMAP; galanin-related peptide; galanin-message-associated peptide; GALN; MGC40167; |
| Gene ID | 51083 |
| mRNA Refseq | NM_015973 |
| Protein Refseq | NP_057057 |
| MIM | 137035 |
| UniProt ID | P22466 |
| ◆ Recombinant Proteins | ||
| Gal-1483M | Recombinant Mouse Gal protein, His & T7-tagged | +Inquiry |
| GAL-289H | Recombinant Human GAL, Fc-tagged | +Inquiry |
| GAL-2117R | Recombinant Rat GAL Protein, His (Fc)-Avi-tagged | +Inquiry |
| GAL-2461R | Recombinant Rat GAL Protein | +Inquiry |
| GAL-3917C | Recombinant Chicken GAL | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GAL-759HCL | Recombinant Human GAL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAL Products
Required fields are marked with *
My Review for All GAL Products
Required fields are marked with *



