Recombinant Full Length Human GAP43 Protein
Cat.No. : | GAP43-178HF |
Product Overview : | Recombinant full length Human GAP43 with an N terminal proprietary tag; Predicted MWt 52.29 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 238 amino acids |
Description : | The protein encoded by this gene has been termed a growth or plasticity protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 52.290kDa inclusive of tags |
AA Sequence : | MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQA SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEK KGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAAT EQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAP AKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETG ESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | GAP43 growth associated protein 43 [ Homo sapiens ] |
Official Symbol | GAP43 |
Synonyms | GAP43; growth associated protein 43; neuromodulin; axonal membrane protein GAP 43; B 50; calmodulin binding protein P 57; nerve growth related peptide GAP43; neural phosphoprotein B 50; neuron growth associated protein 43; PP46; protein F1 |
Gene ID | 2596 |
mRNA Refseq | NM_001130064 |
Protein Refseq | NP_001123536 |
MIM | 162060 |
UniProt ID | P17677 |
◆ Recombinant Proteins | ||
GAP43-6831H | Recombinant Human Growth Associated Protein 43, His-tagged | +Inquiry |
Gap43-6817M | Recombinant Mouse Gap43 protein, His & T7-tagged | +Inquiry |
GAP43-4723H | Recombinant Human GAP43 Protein, GST-tagged | +Inquiry |
GAP43-6205M | Recombinant Mouse GAP43 Protein | +Inquiry |
GAP43-28977TH | Recombinant Human GAP43 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAP43-1911HCL | Recombinant Human GAP43 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GAP43 Products
Required fields are marked with *
My Review for All GAP43 Products
Required fields are marked with *
0
Inquiry Basket