Recombinant Full Length Human GAP43 Protein

• Cat.No.: GAP43-178HF
• Product Overview: Recombinant full length Human GAP43 with an N terminal proprietary tag; Predicted MWt 52.29 kDa inclusive of tag.

Specification

• Description: The protein encoded by this gene has been termed a growth or plasticity protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 52.290kDa inclusive of tags
• Protein Length: 238 amino acids
• AA Sequence: MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQA SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEK KGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAAT EQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAP AKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETG ESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: GAP43 growth associated protein 43 [ Homo sapiens ]
• Official Symbol: GAP43
• Synonyms: GAP43; growth associated protein 43; neuromodulin; axonal membrane protein GAP 43; B 50; calmodulin binding protein P 57; nerve growth related peptide GAP43; neural phosphoprotein B 50; neuron growth associated protein 43; PP46; protein F1
• Gene ID: 2596
• mRNA Refseq: NM_001130064
• Protein Refseq: NP_001123536
• MIM: 162060
• UniProt ID: P17677