Recombinant Full Length Human GAP43 Protein, GST-tagged
Cat.No. : | GAP43-5416HF |
Product Overview : | Human GAP43 full-length ORF ( AAH07936, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 238 amino acids |
Description : | The protein encoded by this gene has been termed a growth or plasticity protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 51.92 kDa |
AA Sequence : | MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GAP43 growth associated protein 43 [ Homo sapiens ] |
Official Symbol | GAP43 |
Synonyms | GAP43; growth associated protein 43; neuromodulin; axonal membrane protein GAP 43; B 50; calmodulin binding protein P 57; nerve growth related peptide GAP43; neural phosphoprotein B 50; neuron growth associated protein 43; PP46; protein F1; neural phosphoprotein B-50; growth-associated protein 43; axonal membrane protein GAP-43; calmodulin-binding protein P-57; nerve growth-related peptide GAP43; neuron growth-associated protein 43; B-50; |
Gene ID | 2596 |
mRNA Refseq | NM_001130064 |
Protein Refseq | NP_001123536 |
MIM | 162060 |
UniProt ID | P17677 |
◆ Recombinant Proteins | ||
GAP43-28977TH | Recombinant Human GAP43 | +Inquiry |
Gap43-6817M | Recombinant Mouse Gap43 protein, His & T7-tagged | +Inquiry |
GAP43-2475R | Recombinant Rat GAP43 Protein | +Inquiry |
GAP43-6831H | Recombinant Human Growth Associated Protein 43, His-tagged | +Inquiry |
Gap43-6818R | Recombinant Rat Gap43 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAP43-1911HCL | Recombinant Human GAP43 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAP43 Products
Required fields are marked with *
My Review for All GAP43 Products
Required fields are marked with *