Recombinant Full Length Human GAP43 Protein, GST-tagged
| Cat.No. : | GAP43-5416HF |
| Product Overview : | Human GAP43 full-length ORF ( AAH07936, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 238 amino acids |
| Description : | The protein encoded by this gene has been termed a growth or plasticity protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq |
| Molecular Mass : | 51.92 kDa |
| AA Sequence : | MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GAP43 growth associated protein 43 [ Homo sapiens ] |
| Official Symbol | GAP43 |
| Synonyms | GAP43; growth associated protein 43; neuromodulin; axonal membrane protein GAP 43; B 50; calmodulin binding protein P 57; nerve growth related peptide GAP43; neural phosphoprotein B 50; neuron growth associated protein 43; PP46; protein F1; neural phosphoprotein B-50; growth-associated protein 43; axonal membrane protein GAP-43; calmodulin-binding protein P-57; nerve growth-related peptide GAP43; neuron growth-associated protein 43; B-50; |
| Gene ID | 2596 |
| mRNA Refseq | NM_001130064 |
| Protein Refseq | NP_001123536 |
| MIM | 162060 |
| UniProt ID | P17677 |
| ◆ Recombinant Proteins | ||
| GAP43-536C | Recombinant Cynomolgus GAP43 Protein, His-tagged | +Inquiry |
| GAP43-6831H | Recombinant Human Growth Associated Protein 43, His-tagged | +Inquiry |
| GAP43-4723H | Recombinant Human GAP43 Protein, GST-tagged | +Inquiry |
| Gap43-6818R | Recombinant Rat Gap43 protein, His & T7-tagged | +Inquiry |
| Gap43-3149M | Recombinant Mouse Gap43 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GAP43-1911HCL | Recombinant Human GAP43 cell lysate | +Inquiry |
| GAP43-170HKCL | Human GAP43 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAP43 Products
Required fields are marked with *
My Review for All GAP43 Products
Required fields are marked with *
