Recombinant Full Length Human GAST Protein, C-Flag-tagged
Cat.No. : | GAST-1804HFL |
Product Overview : | Recombinant Full Length Human GAST Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Gastrin is a hormone whose main function is to stimulate secretion of hydrochloric acid by the gastric mucosa, which results in gastrin formation inhibition. This hormone also acts as a mitogenic factor for gastrointestinal epithelial cells. Gastrin has two biologically active peptide forms, G34 and G17. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 9.2 kDa |
AA Sequence : | MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVA DPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | GAST gastrin [ Homo sapiens (human) ] |
Official Symbol | GAST |
Synonyms | GAS |
Gene ID | 2520 |
mRNA Refseq | NM_000805.5 |
Protein Refseq | NP_000796.1 |
MIM | 137250 |
UniProt ID | P01350 |
◆ Recombinant Proteins | ||
GAST-5459HF | Recombinant Full Length Human GAST Protein, GST-tagged | +Inquiry |
GAST-130H | Recombinant Human GAST protein, His-GST-tagged | +Inquiry |
GAST-2480R | Recombinant Rat GAST Protein | +Inquiry |
GAST-1804HFL | Recombinant Full Length Human GAST Protein, C-Flag-tagged | +Inquiry |
GAST-961H | Recombinant Human GAST Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAST-6014HCL | Recombinant Human GAST 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GAST Products
Required fields are marked with *
My Review for All GAST Products
Required fields are marked with *
0
Inquiry Basket