Recombinant Full Length Human GAST Protein, C-Flag-tagged

Cat.No. : GAST-1804HFL
Product Overview : Recombinant Full Length Human GAST Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Gastrin is a hormone whose main function is to stimulate secretion of hydrochloric acid by the gastric mucosa, which results in gastrin formation inhibition. This hormone also acts as a mitogenic factor for gastrointestinal epithelial cells. Gastrin has two biologically active peptide forms, G34 and G17.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 9.2 kDa
AA Sequence : MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVA DPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Secreted Protein
Full Length : Full L.
Gene Name GAST gastrin [ Homo sapiens (human) ]
Official Symbol GAST
Synonyms GAS
Gene ID 2520
mRNA Refseq NM_000805.5
Protein Refseq NP_000796.1
MIM 137250
UniProt ID P01350

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GAST Products

Required fields are marked with *

My Review for All GAST Products

Required fields are marked with *

0
cart-icon
0
compare icon