Recombinant Full Length Human GAST Protein, GST-tagged
| Cat.No. : | GAST-5459HF |
| Product Overview : | Human GAST full-length ORF ( NP_000796.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 101 amino acids |
| Description : | Gastrin is a hormone whose main function is to stimulate secretion of hydrochloric acid by the gastric mucosa, which results in gastrin formation inhibition. This hormone also acts as a mitogenic factor for gastrointestinal epithelial cells. Gastrin has two biologically active peptide forms, G34 and G17. [provided by RefSeq |
| Molecular Mass : | 37.8 kDa |
| AA Sequence : | MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GAST gastrin [ Homo sapiens ] |
| Official Symbol | GAST |
| Synonyms | GAST; gastrin; GAS; |
| Gene ID | 2520 |
| mRNA Refseq | NM_000805 |
| Protein Refseq | NP_000796 |
| MIM | 137250 |
| UniProt ID | P01350 |
| ◆ Recombinant Proteins | ||
| GAST-2480R | Recombinant Rat GAST Protein | +Inquiry |
| GAST-2136R | Recombinant Rat GAST Protein, His (Fc)-Avi-tagged | +Inquiry |
| GAST-6221M | Recombinant Mouse GAST Protein | +Inquiry |
| GAST-5459HF | Recombinant Full Length Human GAST Protein, GST-tagged | +Inquiry |
| GAST-28284TH | Recombinant Human GAST | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GAST-6014HCL | Recombinant Human GAST 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAST Products
Required fields are marked with *
My Review for All GAST Products
Required fields are marked with *
