Recombinant Full Length Human GATA2 Protein, C-Flag-tagged
Cat.No. : | GATA2-1252HFL |
Product Overview : | Recombinant Full Length Human GATA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50.3 kDa |
AA Sequence : | MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARV SYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSV YPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDG VKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTP KQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCA NCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKC MQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Full Length : | Full L. |
Gene Name | GATA2 GATA binding protein 2 [ Homo sapiens (human) ] |
Official Symbol | GATA2 |
Synonyms | DCML; IMD21; NFE1B; MONOMAC |
Gene ID | 2624 |
mRNA Refseq | NM_032638.5 |
Protein Refseq | NP_116027.2 |
MIM | 137295 |
UniProt ID | P23769 |
◆ Recombinant Proteins | ||
GATA2-6223M | Recombinant Mouse GATA2 Protein | +Inquiry |
GATA2-476H | Recombinant Human GATA2 Protein, His-tagged | +Inquiry |
GATA2-1252HFL | Recombinant Full Length Human GATA2 Protein, C-Flag-tagged | +Inquiry |
GATA2-1186C | Recombinant Chicken GATA2 | +Inquiry |
Gata2-477M | Recombinant Mouse Gata2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GATA2-6013HCL | Recombinant Human GATA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GATA2 Products
Required fields are marked with *
My Review for All GATA2 Products
Required fields are marked with *
0
Inquiry Basket