Recombinant Full Length Human GATA2 Protein, GST-tagged
Cat.No. : | GATA2-5465HF |
Product Overview : | Human GATA2 full-length ORF ( NP_116027.2, 1 a.a. - 480 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 480 amino acids |
Description : | This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants |
Molecular Mass : | 76.9 kDa |
AA Sequence : | MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GATA2 GATA binding protein 2 [ Homo sapiens ] |
Official Symbol | GATA2 |
Synonyms | GATA2; GATA binding protein 2; endothelial transcription factor GATA-2; NFE1B; DCML; MONOMAC; MGC2306; FLJ45948; |
Gene ID | 2624 |
mRNA Refseq | NM_001145661 |
Protein Refseq | NP_001139133 |
MIM | 137295 |
UniProt ID | P23769 |
◆ Recombinant Proteins | ||
GATA2-1186C | Recombinant Chicken GATA2 | +Inquiry |
GATA2-3482M | Recombinant Mouse GATA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GATA2-28983TH | Recombinant Human GATA2 | +Inquiry |
GATA2-5465HF | Recombinant Full Length Human GATA2 Protein, GST-tagged | +Inquiry |
GATA2-136H | Recombinant Human GATA2 protein, Arginine-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GATA2-6013HCL | Recombinant Human GATA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GATA2 Products
Required fields are marked with *
My Review for All GATA2 Products
Required fields are marked with *
0
Inquiry Basket