Recombinant Full Length Human GCET2 Protein, GST-tagged

Cat.No. : GCET2-5168HF
Product Overview : Human GCET2 full-length ORF ( AAH30506, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 178 amino acids
Description : This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Molecular Mass : 45.32 kDa
AA Sequence : MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GCET2 germinal center expressed transcript 2 [ Homo sapiens ]
Official Symbol GCET2
Synonyms GCET2; germinal center expressed transcript 2; germinal center B-cell-expressed transcript 2 protein; HGAL; human germinal center associated lymphoma; MGC40441; human germinal center-associated lymphoma; germinal center-associated lymphoma protein; GCAT2;
Gene ID 257144
mRNA Refseq NM_001190259
Protein Refseq NP_001177188
MIM 607792
UniProt ID Q8N6F7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GCET2 Products

Required fields are marked with *

My Review for All GCET2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon