Recombinant Human GCET2 Protein, GST-tagged
Cat.No. : | GCET2-4791H |
Product Overview : | Human GCET2 full-length ORF ( AAH30506, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq |
Molecular Mass : | 45.32 kDa |
AA Sequence : | MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GCET2 germinal center expressed transcript 2 [ Homo sapiens ] |
Official Symbol | GCET2 |
Synonyms | GCET2; germinal center expressed transcript 2; germinal center B-cell-expressed transcript 2 protein; HGAL; human germinal center associated lymphoma; MGC40441; human germinal center-associated lymphoma; germinal center-associated lymphoma protein; GCAT2; |
Gene ID | 257144 |
mRNA Refseq | NM_001190259 |
Protein Refseq | NP_001177188 |
MIM | 607792 |
UniProt ID | Q8N6F7 |
◆ Recombinant Proteins | ||
GCET2-5168HF | Recombinant Full Length Human GCET2 Protein, GST-tagged | +Inquiry |
GCET2-4791H | Recombinant Human GCET2 Protein, GST-tagged | +Inquiry |
GCET2-368H | Recombinant Human germinal center-associated, signaling and motility, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCET2-5991HCL | Recombinant Human GCET2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GCET2 Products
Required fields are marked with *
My Review for All GCET2 Products
Required fields are marked with *