Recombinant Full Length Human GDAP1 Protein, GST-tagged
Cat.No. : | GDAP1-5193HF |
Product Overview : | Human GDAP1 full-length ORF ( AAH24939, 1 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 290 amino acids |
Description : | This gene encodes a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-Marie-Tooth Disease and neuropathy. Two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq |
Molecular Mass : | 57.64 kDa |
AA Sequence : | MRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMILAFRPRPNYF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GDAP1 ganglioside induced differentiation associated protein 1 [ Homo sapiens ] |
Official Symbol | GDAP1 |
Synonyms | GDAP1; ganglioside induced differentiation associated protein 1; Charcot Marie Tooth neuropathy 4A, CMT4A; ganglioside-induced differentiation-associated protein 1; CMT4; Charcot-Marie-Tooth neuropathy 4A; ganglioside differentiation associated protein 1; CMT4A; CMTRIA; |
Gene ID | 54332 |
mRNA Refseq | NM_001040875 |
Protein Refseq | NP_001035808 |
MIM | 606598 |
UniProt ID | Q8TB36 |
◆ Recombinant Proteins | ||
GDAP1-3476H | Recombinant Human GDAP1 protein, His-tagged | +Inquiry |
RFL34916HF | Recombinant Full Length Human Ganglioside-Induced Differentiation-Associated Protein 1(Gdap1) Protein, His-Tagged | +Inquiry |
GDAP1-4811H | Recombinant Human GDAP1 Protein, GST-tagged | +Inquiry |
GDAP1-2841Z | Recombinant Zebrafish GDAP1 | +Inquiry |
GDAP1-3515M | Recombinant Mouse GDAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDAP1-5974HCL | Recombinant Human GDAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDAP1 Products
Required fields are marked with *
My Review for All GDAP1 Products
Required fields are marked with *
0
Inquiry Basket