Recombinant Full Length Human GDPD3 Protein, GST-tagged

Cat.No. : GDPD3-5275HF
Product Overview : Human GDPD3 full-length ORF ( NP_077283.1, 1 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 256 amino acids
Description : GDPD3 (Glycerophosphodiester Phosphodiesterase Domain Containing 3) is a Protein Coding gene. Among its related pathways are PI Metabolism and Metabolism. GO annotations related to this gene include phosphoric diester hydrolase activity and glycerophosphodiester phosphodiesterase activity. An important paralog of this gene is GDPD1.
Molecular Mass : 56 kDa
AA Sequence : MAQRSDLLELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASEKSSVMKKCKAANPEMPLSFTISRGFWVLLSYYLGLLPFIPIPEKFFFCFLPNIINRTYFPFSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLNEESDFEAAFSVGATGVITDYPTALRHYLDNHGPAARTS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GDPD3 glycerophosphodiester phosphodiesterase domain containing 3 [ Homo sapiens ]
Official Symbol GDPD3
Synonyms GDPD3; glycerophosphodiester phosphodiesterase domain containing 3; glycerophosphodiester phosphodiesterase domain-containing protein 3; MGC4171; FLJ22603;
Gene ID 79153
mRNA Refseq NM_024307
Protein Refseq NP_077283
MIM 616318
UniProt ID Q7L5L3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GDPD3 Products

Required fields are marked with *

My Review for All GDPD3 Products

Required fields are marked with *

0
cart-icon
0
compare icon