Recombinant Full Length Human GDPD3 Protein, GST-tagged
| Cat.No. : | GDPD3-5275HF |
| Product Overview : | Human GDPD3 full-length ORF ( NP_077283.1, 1 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 256 amino acids |
| Description : | GDPD3 (Glycerophosphodiester Phosphodiesterase Domain Containing 3) is a Protein Coding gene. Among its related pathways are PI Metabolism and Metabolism. GO annotations related to this gene include phosphoric diester hydrolase activity and glycerophosphodiester phosphodiesterase activity. An important paralog of this gene is GDPD1. |
| Molecular Mass : | 56 kDa |
| AA Sequence : | MAQRSDLLELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASEKSSVMKKCKAANPEMPLSFTISRGFWVLLSYYLGLLPFIPIPEKFFFCFLPNIINRTYFPFSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLNEESDFEAAFSVGATGVITDYPTALRHYLDNHGPAARTS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GDPD3 glycerophosphodiester phosphodiesterase domain containing 3 [ Homo sapiens ] |
| Official Symbol | GDPD3 |
| Synonyms | GDPD3; glycerophosphodiester phosphodiesterase domain containing 3; glycerophosphodiester phosphodiesterase domain-containing protein 3; MGC4171; FLJ22603; |
| Gene ID | 79153 |
| mRNA Refseq | NM_024307 |
| Protein Refseq | NP_077283 |
| MIM | 616318 |
| UniProt ID | Q7L5L3 |
| ◆ Recombinant Proteins | ||
| GDPD3-1827R | Recombinant Rhesus monkey GDPD3 Protein, His-tagged | +Inquiry |
| GDPD3-6296M | Recombinant Mouse GDPD3 Protein | +Inquiry |
| GDPD3-1648R | Recombinant Rhesus Macaque GDPD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GDPD3-3526M | Recombinant Mouse GDPD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GDPD3-13218H | Recombinant Human GDPD3, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDPD3 Products
Required fields are marked with *
My Review for All GDPD3 Products
Required fields are marked with *
