Recombinant Full Length Human GEMIN7 Protein, GST-tagged

Cat.No. : GEMIN7-5312HF
Product Overview : Human GEMIN7 full-length ORF ( AAH07793, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 131 amino acids
Description : The protein encoded by this gene is a component of the core SMN complex, which is required for pre-mRNA splicing in the nucleus. The encoded protein is found in the nucleoplasm, in nuclear "gems" (Gemini of Cajal bodies), and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Molecular Mass : 40.15 kDa
AA Sequence : MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GEMIN7 gem (nuclear organelle) associated protein 7 [ Homo sapiens ]
Official Symbol GEMIN7
Synonyms GEMIN7; gem (nuclear organelle) associated protein 7; gem-associated protein 7; FLJ13956; gemin 7; gemin-7; SIP3;
Gene ID 79760
mRNA Refseq NM_001007269
Protein Refseq NP_001007270
MIM 607419
UniProt ID Q9H840

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GEMIN7 Products

Required fields are marked with *

My Review for All GEMIN7 Products

Required fields are marked with *

0
cart-icon