Recombinant Full Length Human GEMIN7 Protein, GST-tagged
Cat.No. : | GEMIN7-5312HF |
Product Overview : | Human GEMIN7 full-length ORF ( AAH07793, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 131 amino acids |
Description : | The protein encoded by this gene is a component of the core SMN complex, which is required for pre-mRNA splicing in the nucleus. The encoded protein is found in the nucleoplasm, in nuclear "gems" (Gemini of Cajal bodies), and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq |
Molecular Mass : | 40.15 kDa |
AA Sequence : | MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GEMIN7 gem (nuclear organelle) associated protein 7 [ Homo sapiens ] |
Official Symbol | GEMIN7 |
Synonyms | GEMIN7; gem (nuclear organelle) associated protein 7; gem-associated protein 7; FLJ13956; gemin 7; gemin-7; SIP3; |
Gene ID | 79760 |
mRNA Refseq | NM_001007269 |
Protein Refseq | NP_001007270 |
MIM | 607419 |
UniProt ID | Q9H840 |
◆ Recombinant Proteins | ||
GEMIN7-3531M | Recombinant Mouse GEMIN7 Protein, His (Fc)-Avi-tagged | +Inquiry |
GEMIN7-5312HF | Recombinant Full Length Human GEMIN7 Protein, GST-tagged | +Inquiry |
GEMIN7-4843H | Recombinant Human GEMIN7 Protein, GST-tagged | +Inquiry |
GEMIN7-7906Z | Recombinant Zebrafish GEMIN7 | +Inquiry |
GEMIN7-109H | Recombinant Human GEMIN7 Protein, HIS-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GEMIN7-5959HCL | Recombinant Human GEMIN7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GEMIN7 Products
Required fields are marked with *
My Review for All GEMIN7 Products
Required fields are marked with *