Recombinant Full Length Human GFOD1 Protein, GST-tagged

Cat.No. : GFOD1-3258HF
Product Overview : Human C6orf114 full-length ORF (NP_149060.1, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 136 amino acids
Description : GFOD1 (Glucose-Fructose Oxidoreductase Domain Containing 1) is a Protein Coding gene. Diseases associated with GFOD1 include Attention Deficit-Hyperactivity Disorder. GO annotations related to this gene include oxidoreductase activity. An important paralog of this gene is GFOD2.
Molecular Mass : 42.4 kDa
AA Sequence : MGDSRRDVLHEPAIALLSSPQTQSRLQIDAFIARRCWGSQWDITGYIHQQDFPTAVFIGFSNEFNICIPHPFTEWLQCVRKYSQSWGVRKGQRHIRYGMCSERTHHLSRTYSSLLEREEKLAFYGVLTMCQIWSET
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GFOD1 glucose-fructose oxidoreductase domain containing 1 [ Homo sapiens ]
Official Symbol GFOD1
Synonyms GFOD1; glucose-fructose oxidoreductase domain containing 1; C6orf114, chromosome 6 open reading frame 114; glucose-fructose oxidoreductase domain-containing protein 1; ADG 90; FLJ20330; ADG-90; C6orf114; FLJ30569; MGC70653; RP11-501I19.1;
Gene ID 54438
mRNA Refseq NM_001242628
Protein Refseq NP_001229557
MIM 619932
UniProt ID Q9NXC2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GFOD1 Products

Required fields are marked with *

My Review for All GFOD1 Products

Required fields are marked with *

0
cart-icon