Recombinant Full Length Human GHRL Protein, GST-tagged
Cat.No. : | GHRL-5253HF |
Product Overview : | Human GHRL full-length ORF ( AAH25791.1, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 117 amino acids |
Description : | This gene encodes ghrelin-obestatin preproprotein, which generates ghrelin and obestatin. Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release. Obestatin was initially reported to be an endogenous ligand for the orphan G protein-coupled receptor GPR39 and was involved in satiety and decreased food intake; however, these findings are controversial. Recent reports show that obestatin is involved in inhibiting thirst and anxiety, improving memory, regulating sleep, affecting cell proliferation, and increasing the secretion of pancreatic juice enzymes. Alternative promoters and alternative splicing result in multiple transcript variants, some of which encode different protein isoforms and some of which do not encode a protein but may regulate the ghrelin-obestatin preproprotein expression. In addition, antisense transcripts for this gene have been identified and may also function in regulation of the ghrelin-obestatin preproprotein expression. [provided by RefSeq |
Molecular Mass : | 38.61 kDa |
AA Sequence : | MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GHRL ghrelin/obestatin prepropeptide [ Homo sapiens ] |
Official Symbol | GHRL |
Synonyms | GHRL; ghrelin/obestatin prepropeptide; ghrelin, growth hormone secretagogue receptor ligand; appetite-regulating hormone; ghrelin; MTLRP; obestatin; motilin-related peptide; growth hormone secretagogue; ghrelin/obestatin preprohormone; growth hormone-releasing peptide; |
Gene ID | 51738 |
mRNA Refseq | NM_001134941 |
Protein Refseq | NP_001128413 |
MIM | 605353 |
UniProt ID | Q9UBU3 |
◆ Recombinant Proteins | ||
GHRL-2749H | Recombinant Human GHRL Protein (Ser25-Lys117), His tagged | +Inquiry |
GHRL-4892H | Recombinant Human GHRL Protein, GST-tagged | +Inquiry |
GHRL-7597C | Recombinant Cat GHRL protein(24-51aa), His-KSI-tagged | +Inquiry |
GHRL-1665R | Recombinant Rhesus Macaque GHRL Protein, His (Fc)-Avi-tagged | +Inquiry |
GHRL-4132H | Recombinant Human GHRL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GHRL-5941HCL | Recombinant Human GHRL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GHRL Products
Required fields are marked with *
My Review for All GHRL Products
Required fields are marked with *
0
Inquiry Basket