Recombinant Full Length Human GJB4 Protein, GST-tagged
Cat.No. : | GJB4-5296HF |
Product Overview : | Human GJB4 full-length ORF ( AAH34709, 1 a.a. - 266 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 266 amino acids |
Description : | This gene encodes a transmembrane connexin protein that is a component of gap junctions. Mutations in this gene have been associated with erythrokeratodermia variabilis, progressive symmetric erythrokeratoderma and hearing impairment. [provided by RefSeq, Dec 2009] |
Molecular Mass : | 55.00 kDa |
AA Sequence : | MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAAVDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVGKRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GJB4 gap junction protein, beta 4, 30.3kDa [ Homo sapiens ] |
Official Symbol | GJB4 |
Synonyms | GJB4; gap junction protein, beta 4, 30.3kDa; gap junction protein, beta 4, gap junction protein, beta 4 (connexin 30.3); gap junction beta-4 protein; connexin 30.3; CX30.3; connexin-30.3; EKV; MGC21116; |
Gene ID | 127534 |
mRNA Refseq | NM_153212 |
Protein Refseq | NP_694944 |
MIM | 605425 |
UniProt ID | Q9NTQ9 |
◆ Recombinant Proteins | ||
GJB4-2554R | Recombinant Rat GJB4 Protein | +Inquiry |
GJB4-4931H | Recombinant Human GJB4 Protein, GST-tagged | +Inquiry |
GJB4-13279H | Recombinant Human GJB4, GST-tagged | +Inquiry |
RFL35929MF | Recombinant Full Length Mouse Gap Junction Beta-4 Protein(Gjb4) Protein, His-Tagged | +Inquiry |
Gjb4-3219M | Recombinant Mouse Gjb4 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GJB4-5917HCL | Recombinant Human GJB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GJB4 Products
Required fields are marked with *
My Review for All GJB4 Products
Required fields are marked with *