Recombinant Full Length Human GJB4 Protein, GST-tagged

Cat.No. : GJB4-5296HF
Product Overview : Human GJB4 full-length ORF ( AAH34709, 1 a.a. - 266 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 266 amino acids
Description : This gene encodes a transmembrane connexin protein that is a component of gap junctions. Mutations in this gene have been associated with erythrokeratodermia variabilis, progressive symmetric erythrokeratoderma and hearing impairment. [provided by RefSeq, Dec 2009]
Molecular Mass : 55.00 kDa
AA Sequence : MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAAVDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVGKRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GJB4 gap junction protein, beta 4, 30.3kDa [ Homo sapiens ]
Official Symbol GJB4
Synonyms GJB4; gap junction protein, beta 4, 30.3kDa; gap junction protein, beta 4, gap junction protein, beta 4 (connexin 30.3); gap junction beta-4 protein; connexin 30.3; CX30.3; connexin-30.3; EKV; MGC21116;
Gene ID 127534
mRNA Refseq NM_153212
Protein Refseq NP_694944
MIM 605425
UniProt ID Q9NTQ9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GJB4 Products

Required fields are marked with *

My Review for All GJB4 Products

Required fields are marked with *

0
cart-icon