Recombinant Full Length Human GLDN Protein
Cat.No. : | GLDN-5316HF |
Product Overview : | Human GLDN full-length ORF (ADR83005.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 66 amino acids |
Description : | This gene encodes a protein that contains olfactomedin-like and collagen-like domains. The encoded protein, which exists in both transmembrane and secreted forms, promotes formation of the nodes of Ranvier in the peripheral nervous system. Mutations in this gene cause a form of lethal congenital contracture syndrome in human patients. Autoantibodies to the encoded protein have been identified in sera form patients with multifocal motor neuropathy. [provided by RefSeq, May 2017] |
Form : | Liquid |
Molecular Mass : | 47 kDa |
AA Sequence : | MVDLCNSTKGICLTGPSGPPGPPGAGGLPGHNGLDGQPGPQGPKGEKGANGKRGKMGIPGAAGNPGERGEKGDHGELGLQGNEGPPGQKGEKGDKGDVSNDVLLAGAKGDQGPPGPPGPPGPPGPPGPPGSRRAKGPRQPNMFNGQCPGETCAIPNDDTLVGKADEKASEHHSPQAESMITSIGNPVQVLKVTETFGTWIRESANKSDDRIWVTEHFSGIMVKEFKDQPSLLNGSYTFIHLPYYFHGCGHVVYNNSLYYHKGGSNTLVRFEFGQETSQTLKLENALYFDRKYLFANSKTYFNLAVDEKGLWIIYASSVDGSSILVAQLDERTFSVVQHVNTTYPKSKAGNAFIARGILYVTDTKDMRVTFAFDLLGGKQINANFDLRTSQSVLAMLAYNMRDQHLYSWEDGHLMLYPVQFLSTTLNQ |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | GLDN gliomedin [ Homo sapiens ] |
Official Symbol | GLDN |
Synonyms | GLDN; gliomedin; collomin, COLM; CLOM; colmedin; CRG L2; UNC 112; collomin; COLM; CRGL2; CRG-L2; UNC-112; FLJ23917; |
Gene ID | 342035 |
mRNA Refseq | NM_181789 |
Protein Refseq | NP_861454 |
MIM | 608603 |
UniProt ID | Q6ZMI3 |
◆ Recombinant Proteins | ||
GLDN-3592M | Recombinant Mouse GLDN Protein, His (Fc)-Avi-tagged | +Inquiry |
Gldn-3222M | Recombinant Mouse Gldn Protein, Myc/DDK-tagged | +Inquiry |
GLDN-4951H | Recombinant Human GLDN Protein | +Inquiry |
GLDN-1671H | Recombinant Human GLDN Protein, GST-tagged | +Inquiry |
GLDN-2216R | Recombinant Rat GLDN Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLDN Products
Required fields are marked with *
My Review for All GLDN Products
Required fields are marked with *
0
Inquiry Basket