Recombinant Full Length Human GLDN Protein, C-Flag-tagged
| Cat.No. : | GLDN-328HFL |
| Product Overview : | Recombinant Full Length Human GLDN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a protein that contains olfactomedin-like and collagen-like domains. The encoded protein, which exists in both transmembrane and secreted forms, promotes formation of the nodes of Ranvier in the peripheral nervous system. Mutations in this gene cause a form of lethal congenital contracture syndrome in human patients. Autoantibodies to the encoded protein have been identified in sera form patients with multifocal motor neuropathy. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 58.8 kDa |
| AA Sequence : | MARGAEGGRGDAGWGLRGALAAVALLSALNAAGTVFALCQWRGLSSALRALEAQRGREQREDSALRSFLA ELSRAPRGASAPPQDPASSARNKRSHSGEPAPHIRAESHDMLMMMTYSMVPIRVMVDLCNSTKGICLTGP SGPPGPPGAGGLPGHNGLDGQPGPQGPKGEKGANGKRGKMGIPGAAGNPGERGEKGDHGELGLQGNEGPP GQKGEKGDKGDVSNDVLLAGAKGDQGPPGPPGPPGPPGPPGPPGSRRAKGPRQPSMFNGQCPGETCAIPN DDTLVGKADEKASEHHSPQAESMITSIGNPVQVLKVTETFGTWIRESANKSDDRIWVTEHFSGIMVKEFK DQPSLLNGSYTFIHLPYYFHGCGHVVYNNSLYYHKGGSNTLVRFEFGQETSQTLKLENALYFDRKYLFAN SKTYFNLAVDEKGLWIIYASSVDGSSILVAQLDERTFSVVQHVNTTYPKSKAGNAFIARGILYVTDTKDM RVTFAFDLLGGKQINANFDLRTSQSVLAMLAYNMRDQHLYSWEDGHLMLYPVQFLSTTLNQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Transmembrane |
| Full Length : | Full L. |
| Gene Name | GLDN gliomedin [ Homo sapiens (human) ] |
| Official Symbol | GLDN |
| Synonyms | CLOM; COLM; CRGL2; CRG-L2; LCCS11; UNC-112; UNC-122 |
| Gene ID | 342035 |
| mRNA Refseq | NM_181789.4 |
| Protein Refseq | NP_861454.2 |
| MIM | 608603 |
| UniProt ID | Q6ZMI3 |
| ◆ Recombinant Proteins | ||
| GLDN-328HFL | Recombinant Full Length Human GLDN Protein, C-Flag-tagged | +Inquiry |
| GLDN-1671H | Recombinant Human GLDN Protein, GST-tagged | +Inquiry |
| GLDN-5024Z | Recombinant Zebrafish GLDN | +Inquiry |
| GLDN-5316HF | Recombinant Full Length Human GLDN Protein | +Inquiry |
| GLDN-1252H | Recombinant Human GLDN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLDN Products
Required fields are marked with *
My Review for All GLDN Products
Required fields are marked with *
