Recombinant Full Length Human GLIPR1L2 Protein, GST-tagged
| Cat.No. : | GLIPR1L2-5331HF |
| Product Overview : | Human GLIPR1L2 full-length ORF ( NP_689649.1, 1 a.a. - 253 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 253 amino acids |
| Description : | This gene encodes a member of the cysteine-rich secretory protein, antigen 5, and pathogenesis-related 1 superfamily. Members of this family have roles in a variety of processes, including cancer and immune defense. This gene is located in a cluster with two related genes on chromosome 12. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012] |
| Molecular Mass : | 55.4 kDa |
| AA Sequence : | MEAARPFAREWRAQSLPLAVGGVLKLRLCELWLLLLGSSLNARFLPDEEDVDFINEYVNLHNELRGDVIPRGSNLRFMTWDVALSRTARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENMWVGPENEFTASIAIRSWHAEKKMYNFENGSCSGDCSNYIQLVWDHSYKVGCAVTPCSKIGHIIHAAIFICNYAPGGTLTRRPYEPGIFCTRCGRRDKCTDFLCSKIKKINMKKMHNGLDKKNKRLNTSFLWSC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GLIPR1L2 GLI pathogenesis-related 1 like 2 [ Homo sapiens ] |
| Official Symbol | GLIPR1L2 |
| Synonyms | GLIPR1L2; GLI pathogenesis-related 1 like 2; GLIPR1-like protein 2; MGC39497; |
| Gene ID | 144321 |
| mRNA Refseq | NM_152436 |
| Protein Refseq | NP_689649 |
| MIM | 610394 |
| UniProt ID | Q4G1C9 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLIPR1L2 Products
Required fields are marked with *
My Review for All GLIPR1L2 Products
Required fields are marked with *
