Recombinant Full Length Human GLMN Protein, GST-tagged
Cat.No. : | GLMN-5335HF |
Product Overview : | Human GLMN full-length ORF ( AAH01257, 1 a.a. - 594 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 594 amino acids |
Description : | This gene encodes a phosphorylated protein that is a member of a Skp1-Cullin-F-box-like complex. The protein is essential for normal development of the vasculature and mutations in this gene have been associated with glomuvenous malformations, also called glomangiomas. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. [provided by RefSeq |
Molecular Mass : | 91.08 kDa |
AA Sequence : | MAVEELQSIIKRCQILEEQDFKEEDFGLFQLAGQRCIEEGHTDQLLEIIQNEKNKVIIKNMGWNLVGPVVRCLLCKDKEDSKRKVYFLIFDLLVKLCNPKELLLGLLELIEEPSGKQISQSILLLLQPLQTVIQKLHNKAYSIGLALSTLWNQLSLLPVPYSKEQIQMDDYGLCQCCKALIEFTKPFVEEVIDNKENSLENEKLKDELLKFCFKSLKCPLLTAQFFEQSEEGGNDPFRYFASEIIGFLSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESVISKGLELLENSLLRIEDNSLLYQYLEIKSFLTVPQGLVKVMTLCPIETLRKKSLAMLQLYINKLDSQGKYTLFRCLLNTSNHSGVEAFIIQNIKNQIDMSLKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYLVIKDNENDNQTGLWTELGNIENNFLKPLHIGLNMSKAHYEAEIKNSQEAQKSKDLCSITVSGEEIPNMPPEMQLKVLHSALFTFDLIESVLARVEELIEIKTKSTSEENIGIK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GLMN glomulin, FKBP associated protein [ Homo sapiens ] |
Official Symbol | GLMN |
Synonyms | GLMN; glomulin, FKBP associated protein; venous malformation with glomus cells, VMGLOM; glomulin; FAP48; FKBPAP; GLML; GVM; FKBP-associated protein; FK506-binding protein-associated protein; FAP; FAP68; VMGLOM; |
Gene ID | 11146 |
mRNA Refseq | NM_053274 |
Protein Refseq | NP_444504 |
MIM | 601749 |
UniProt ID | Q92990 |
◆ Recombinant Proteins | ||
GLMN-5335HF | Recombinant Full Length Human GLMN Protein, GST-tagged | +Inquiry |
GLMN-4965H | Recombinant Human GLMN Protein, GST-tagged | +Inquiry |
GLMN-5740H | Recombinant Human GLMN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Glmn-1291M | Recombinant Mouse Glmn protein, His & T7-tagged | +Inquiry |
GLMN-3598M | Recombinant Mouse GLMN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLMN-5900HCL | Recombinant Human GLMN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLMN Products
Required fields are marked with *
My Review for All GLMN Products
Required fields are marked with *