Recombinant Full Length Human GLRX Protein, C-Flag-tagged
| Cat.No. : | GLRX-1901HFL |
| Product Overview : | Recombinant Full Length Human GLRX Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial for several signalling pathways by controlling the S-glutathionylation status of signalling mediators. It is involved in beta-amyloid toxicity and Alzheimer's disease. Multiple alternatively spliced transcript variants encoding the same protein have been identified. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 11.6 kDa |
| AA Sequence : | MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTV PRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ myc-FLAG tag |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome |
| Full Length : | Full L. |
| Gene Name | GLRX glutaredoxin [ Homo sapiens (human) ] |
| Official Symbol | GLRX |
| Synonyms | GRX; GRX1 |
| Gene ID | 2745 |
| mRNA Refseq | NM_002064.3 |
| Protein Refseq | NP_002055.1 |
| MIM | 600443 |
| UniProt ID | P35754 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLRX Products
Required fields are marked with *
My Review for All GLRX Products
Required fields are marked with *




