Recombinant Full Length Human GLS Protein
Cat.No. : | GLS-270HFL |
Product Overview : | Recombinant Full Length Human GLS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Protein Length : | 1-669 a.a. |
Description : | This gene encodes the K-type mitochondrial glutaminase. The encoded protein is an phosphate-activated amidohydrolase that catalyzes the hydrolysis of glutamine to glutamate and ammonia. This protein is primarily expressed in the brain and kidney plays an essential role in generating energy for metabolism, synthesizing the brain neurotransmitter glutamate and maintaining acid-base balance in the kidney. Alternate splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 73.3 kDa |
AA Sequence : | MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGGGGWPAEPLAR GLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDGPGETDAFGNSEGKELVASGENKIKQGLLPSLE DLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVL LTQAFRRKFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKV PFCLQSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVN NAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSI EVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILL VVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRREGGDQRVKSVINLLFA AYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHF GHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLLSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, D-Glutamine and D-glutamate metabolism, Metabolic pathways, Nitrogen metabolism |
Full Length : | Full L. |
Gene Name | GLS glutaminase [ Homo sapiens (human) ] |
Official Symbol | GLS |
Synonyms | GAC; GAM; KGA; GLS1; AAD20; DEE71; GDPAG; CASGID; EIEE71 |
Gene ID | 2744 |
mRNA Refseq | NM_014905.5 |
Protein Refseq | NP_055720.3 |
MIM | 138280 |
UniProt ID | O94925 |
◆ Recombinant Proteins | ||
GLS-2228R | Recombinant Rat GLS Protein, His (Fc)-Avi-tagged | +Inquiry |
GLS-6588H | Recombinant Human GLS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GLS-2971H | Recombinant Human GLS protein, GST-tagged | +Inquiry |
GLS-08H | Active Recombinant Human GLS Protein, His-tagged | +Inquiry |
GLS-2907C | Recombinant Chicken GLS | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLS Products
Required fields are marked with *
My Review for All GLS Products
Required fields are marked with *