Recombinant Full Length Human GLUL Protein, GST-tagged
| Cat.No. : | GLUL-5361HF |
| Product Overview : | Human GLUL full-length ORF ( AAH10037, 1 a.a. - 373 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 373 amino acids |
| Description : | Glutamine is a main source of energy and is involved in cell proliferation, inhibition of apoptosis, and cell signaling (Haberle et al., 2005 [PubMed 16267323]). Fetal glutamine requirements are very high and depend largely on active glutamine synthesis and the release of glutamine into the fetal circulation by the placenta. Glutamine synthetase (EC 6.3.1.2), also called glutamate-ammonia ligase (GLUL), is expressed throughout the body and plays an important role in controlling body pH and in removing ammonia from the circulation. The enzyme clears L-glutamate, the major neurotransmitter in the central nervous system, from neuronal synapses (see references in Clancy et al., 1996 [PubMed 8975719]).[supplied by OMIM |
| Molecular Mass : | 66.77 kDa |
| AA Sequence : | MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GLUL glutamate-ammonia ligase [ Homo sapiens ] |
| Official Symbol | GLUL |
| Synonyms | GLUL; glutamate-ammonia ligase; GLNS, glutamate ammonia ligase (glutamine synthase); glutamine synthetase; glutamine synthase; glutamate decarboxylase; glutamate--ammonia ligase; proliferation-inducing protein 43; cell proliferation-inducing protein 59; GS; GLNS; PIG43; PIG59; |
| Gene ID | 2752 |
| mRNA Refseq | NM_001033044 |
| Protein Refseq | NP_001028216 |
| MIM | 138290 |
| UniProt ID | P15104 |
| ◆ Recombinant Proteins | ||
| GLUL-2580R | Recombinant Rat GLUL Protein | +Inquiry |
| GLUL-6440M | Recombinant Mouse GLUL Protein | +Inquiry |
| Glul-8218M | Recombinant Mouse Glul protein, His-tagged | +Inquiry |
| GLUL-2911C | Recombinant Chinese hamster GLUL protein(2-373aa), His-tagged | +Inquiry |
| GLUL-3616M | Recombinant Mouse GLUL Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GLUL-5890HCL | Recombinant Human GLUL 293 Cell Lysate | +Inquiry |
| GLUL-177HKCL | Human GLUL Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLUL Products
Required fields are marked with *
My Review for All GLUL Products
Required fields are marked with *
