Recombinant Full Length Human GMFB Protein, GST-tagged
| Cat.No. : | GMFB-5409HF |
| Product Overview : | Human GMFB full-length ORF ( AAH05359, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 154 amino acids |
| Description : | GMFB (Glia Maturation Factor Beta) is a Protein Coding gene. Among its related pathways are Development Angiotensin activation of ERK and Signal transduction_Erk Interactions- Inhibition of Erk. GO annotations related to this gene include actin binding and growth factor activity. An important paralog of this gene is GMFG. |
| Molecular Mass : | 42.68 kDa |
| AA Sequence : | MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFTNVNFCVSKVFMY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GMFB glia maturation factor, beta [ Homo sapiens ] |
| Official Symbol | GMFB |
| Synonyms | GMFB; glia maturation factor, beta; glia maturation factor beta; GMF; GMF-beta; |
| Gene ID | 2764 |
| mRNA Refseq | NM_004124 |
| Protein Refseq | NP_004115 |
| MIM | 601713 |
| UniProt ID | P60983 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GMFB Products
Required fields are marked with *
My Review for All GMFB Products
Required fields are marked with *



