Recombinant Full Length Human GMFG Protein, GST-tagged
Cat.No. : | GMFG-5411HF |
Product Overview : | Human GMFG full-length ORF ( NP_004868.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 142 amino acids |
Description : | GMFG (Glia Maturation Factor Gamma) is a Protein Coding gene. Among its related pathways are GPCR Pathway and Phospholipase-C Pathway. GO annotations related to this gene include actin binding and enzyme activator activity. An important paralog of this gene is GMFB. |
Molecular Mass : | 43.2 kDa |
AA Sequence : | MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GMFG glia maturation factor, gamma [ Homo sapiens ] |
Official Symbol | GMFG |
Synonyms | GMFG; glia maturation factor, gamma; glia maturation factor gamma; GMF-GAMMA; MGC126867; |
Gene ID | 9535 |
mRNA Refseq | NM_004877 |
Protein Refseq | NP_004868 |
MIM | 604104 |
UniProt ID | O60234 |
◆ Recombinant Proteins | ||
GMFG-2241R | Recombinant Rat GMFG Protein, His (Fc)-Avi-tagged | +Inquiry |
GMFG-28150TH | Recombinant Human GMFG | +Inquiry |
GMFG-3311H | Recombinant Human GMFG Protein (Val6-Thr126), N-His tagged | +Inquiry |
GMFG-3717Z | Recombinant Zebrafish GMFG | +Inquiry |
GMFG-299H | Recombinant Human GMFG protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMFG-5882HCL | Recombinant Human GMFG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GMFG Products
Required fields are marked with *
My Review for All GMFG Products
Required fields are marked with *