Recombinant Full Length Human GNB2 Protein, GST-tagged

Cat.No. : GNB2-5358HF
Product Overview : Human GNB2 full-length ORF ( AAH10073, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 340 amino acids
Description : Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. This gene contains a trinucleotide (CCG) repeat length polymorphism in its 5 UTR. [provided by RefSeq
Molecular Mass : 63.14 kDa
AA Sequence : MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GNB2 guanine nucleotide binding protein (G protein), beta polypeptide 2 [ Homo sapiens ]
Official Symbol GNB2
Synonyms GNB2; guanine nucleotide binding protein (G protein), beta polypeptide 2; guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2; G protein; beta 2 subunit; guanine nucleotide binding protein G(I)/G(S)/G(T) beta subunit 2; signal transducing guanine nucleotide binding regulatory protein beta subunit; transducin beta chain 2; g protein subunit beta-2; G protein, beta-2 subunit; guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2; signal-transducing guanine nucleotide-binding regulatory protein beta subunit;
Gene ID 2783
mRNA Refseq NM_005273
Protein Refseq NP_005264
MIM 139390
UniProt ID P62879

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNB2 Products

Required fields are marked with *

My Review for All GNB2 Products

Required fields are marked with *

0
cart-icon
0
compare icon